ATP1B2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATP1B2 Polyclonal antibody (22338-1-AP)

ATP1B2 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22338-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

Adhesion molecule in glia, ATPase Na+/K+ beta 2, Sodium/potassium-dependent ATPase subunit beta-2, Sodium/potassium-transporting ATPase subunit beta-2

• 

  WB analysis of mouse brain using 22338-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22338-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 22338-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C2C12 using 22338-1-AP

  C2C12 cell were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 22338-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 22338-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22338-1-AP (ATP1B2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse skeletal muscle using 22338-1-AP

  IP result of anti-ATP1B2 (IP:22338-1-AP, 4ug; Detection:22338-1-AP 1:1000) with mouse skeletal muscle tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 22338-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain slide using 22338-1-AP (ATP1B2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 22338-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain slide using 22338-1-AP (ATP1B2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 22338-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using ATP1B2 antibody (22338-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATP1B2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, C2C12 cells, C6 cells, mouse skeletal muscle tissue, rat brain tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22338-1-AP targets ATP1B2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17818

  Product name: Recombinant human ATP1B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 64-171 aa of BC126175

  Sequence: QTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGY

• Full Name: ATPase, Na+/K+ transporting, beta 2 polypeptide
• Calculated Molecular Weight: 290 aa, 33 kDa
• Observed Molecular Weight: 45-65 kDa
• GenBank Accession Number: BC126175
• Gene Symbol: ATP1B2
• Gene ID (NCBI): 482
• RRID: AB_2879077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14415
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B2 is the β2 subunit of Na+/K+-ATPase which is an essential membrane-bound enzyme responsible for the transport of Na+ and K+ in most eukaryotic cells. ATP1B2 is also called the adhesion molecule on glia (AMOG) and it is highly expressed in normal glia. It is a heavily glycosylated protein that plays a role in cellular adhesion in the CNS. Recently differential expression of ATP1B2 has been found in some glioneuronal tumors (PMID: 23887941, 19371356). This antibody recognizes the endogenous ATP1B2 protein in human brain. The bands between 45 kDa and 65 kDa represent the glycosylated forms of ATP1B2 in different levels (PMID: 8918259).

Publications

What published studies show

The antibody targeting ATP1B2 (Na⁺/K⁺-ATPase β2 subunit), catalog number 22338-1-AP, has 13 total citations. These appear in journals including Redox Biology, Journal of Neuroscience, Journal of Applied Physiology, Cell Molecular Gastroenterology and Hepatology, Cancer Cell International, World Journal of Biological Psychiatry, Experimental Physiology, European Journal of Applied Physiology, Disease Models & Mechanisms, Neuroscience Letters, Medical Science Monitor, and bioRxiv. Research fields span exercise/muscle physiology, neuroscience (photoreceptor biology, schizophrenia), liver autophagy, cancer, and spinal cord injury.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Redox Biol; Caveolin 1-related autophagy initiated by aldosterone-induced oxidation promotes liver sinusoidal endothelial cells defenestration.; Authors - Xiaoying Luo
mouse	IF	Cell Mol Gastroenterol Hepatol; Self-renewing Monolayer of Primary Colonic or Rectal Epithelial Cells.; Authors - Yuli Wang
human	WB	Cancer Cell Int; Spider venom components decrease glioblastoma cell migration and invasion through RhoA-ROCK and Na+/K+-ATPase β2: potential molecular entities to treat invasive brain cancer.; Authors - Natália Barreto
mouse	WB,IF	J Neurosci; ARL13B, a Joubert Syndrome-associated protein, is critical for retinogenesis and elaboration of mouse photoreceptor outer segments.; Authors - Tanya L Dilan
human	WB	J Appl Physiol (1985); Cold-water immersion after training sessions: effects on fiber type-specific adaptations in muscle K+ transport proteins to sprint-interval training in men.; Authors - Danny Christiansen
rat,human	WB	J Appl Physiol (1985); Effects of testosterone suppression, hindlimb immobilization, and recovery on [3H]ouabain binding site content and Na+, K+-ATPase isoforms in rat soleus muscle.; Authors - Muath M Altarawneh