CoraLite® Plus 647-conjugated ATP1B2 Polyclonal antibody

ATP1B2 Polyclonal Antibody for IF-P
Cat No. CL647-22338

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Adhesion molecule in glia, ATPase Na+/K+ beta 2, Sodium/potassium-dependent ATPase subunit beta-2, Sodium/potassium-transporting ATPase subunit beta-2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-22338 targets ATP1B2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17818

Product name: Recombinant human ATP1B2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 64-171 aa of BC126175

Sequence: QTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGY

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 2 polypeptide
Calculated Molecular Weight 290 aa, 33 kDa
Observed Molecular Weight 45-65 kDa
GenBank Accession NumberBC126175
Gene Symbol ATP1B2
Gene ID (NCBI) 482
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14415
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATP1B2 is the β2 subunit of Na+/K+-ATPase which is an essential membrane-bound enzyme responsible for the transport of Na+ and K+ in most eukaryotic cells. ATP1B2 is also called the adhesion molecule on glia (AMOG) and it is highly expressed in normal glia. It is a heavily glycosylated protein that plays a role in cellular adhesion in the CNS. Recently differential expression of ATP1B2 has been found in some glioneuronal tumors (PMID: 23887941, 19371356). This antibody recognizes the endogenous ATP1B2 protein in human brain. The bands between 45 kDa and 65 kDa represent the glycosylated forms of ATP1B2 in different levels (PMID: 8918259).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 ATP1B2 antibody CL647-22338Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...