Tested Applications
| Positive WB detected in | mouse heart tissue, HeLa cells, mouse skeletal muscle tissue, mouse liver tissue |
| Positive IP detected in | HEK-293T cells |
| Positive IHC detected in | human liver tissue, human brain tissue, human heart tissue, human kidney tissue, human skin tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15999-1-AP targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8571 Product name: Recombinant human ATP5F1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-256 aa of BC005366 Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM Predict reactive species |
| Full Name | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 |
| Calculated Molecular Weight | 256 aa, 29 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC005366 |
| Gene Symbol | ATP5F1 |
| Gene ID (NCBI) | 515 |
| RRID | AB_2258817 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ATP5F1 antibody 15999-1-AP | Download protocol |
| IF protocol for ATP5F1 antibody 15999-1-AP | Download protocol |
| IHC protocol for ATP5F1 antibody 15999-1-AP | Download protocol |
| IP protocol for ATP5F1 antibody 15999-1-AP | Download protocol |
| WB protocol for ATP5F1 antibody 15999-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ATP5F1 Polyclonal antibody (Cat# 15999-1-AP) has 30 citations in journals including Science, Cell, Immunity, Advanced Materials, Nucleic Acids Research, PNAS, Journal of Biological Chemistry, Cell Death & Disease, Free Radical Biology and Medicine, and Cell Reports. Research fields span mitochondrial biology and ATP synthesis, cancer (lung, colorectal, breast, glioma, melanoma), cardiology, metabolism, immunology, neurology, and tissue regeneration.
| Species | Application | Title |
|---|---|---|
Science Mitochondrial remodeling and ischemic protection by G protein-coupled receptor 35 agonists | ||
Immunity Acute suppression of mitochondrial ATP production prevents apoptosis and provides an essential signal for NLRP3 inflammasome activation | ||
Adv Mater Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration | ||
Nucleic Acids Res Human TRUB1 is a highly conserved pseudouridine synthase responsible for the formation of Ψ55 in mitochondrial tRNAAsn, tRNAGln, tRNAGlu and tRNAPro | ||
J Exp Clin Cancer Res ROS/PI3K/Akt and Wnt/β-catenin signalings activate HIF-1α-induced metabolic reprogramming to impart 5-fluorouracil resistance in colorectal cancer. |
Reviews
What customers say
Both reviewers gave this product a 5-star rating. Each used it for Western Blot at a 1:1000 dilution on mouse heart tissue or cells, and both reported strong, clear signals and excellent performance overall.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
siting (Verified Customer) (07-13-2020) | very good signal
 |
Yan (Verified Customer) (01-28-2020) | It worked very well with mouse heart tissue for western blot.
|
