ATP5F1 Polyclonal antibody

ATP5F1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 15999-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA

ATP synthase F(0) complex subunit B1, mitochondrial, ATP synthase peripheral stalk-membrane subunit b, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, ATP5F 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue
Positive IHC detected inhuman liver tissue, human brain tissue, human heart tissue, human kidney tissue, human skin tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15999-1-AP targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8571

Product name: Recombinant human ATP5F1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-256 aa of BC005366

Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
Calculated Molecular Weight 256 aa, 29 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC005366
Gene Symbol ATP5F1
Gene ID (NCBI) 515
RRIDAB_2258817
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24539
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.

Protocols

Product Specific Protocols
FC protocol for ATP5F1 antibody 15999-1-APDownload protocol
IF protocol for ATP5F1 antibody 15999-1-APDownload protocol
IHC protocol for ATP5F1 antibody 15999-1-APDownload protocol
WB protocol for ATP5F1 antibody 15999-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Adv Mater

Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration

Authors - Zhuo Li
ratWB

Proc Natl Acad Sci U S A

Evaluation of intramitochondrial ATP levels identifies G0/G1 switch gene 2 as a positive regulator of oxidative phosphorylation.

Authors - Hidetaka Kioka
mouseWB,IHC

Part Fibre Toxicol

Transcriptomics of single dose and repeated carbon black and ozone inhalation co-exposure highlight progressive pulmonary mitochondrial dysfunction.

Authors - Quincy A Hathaway
humanWB

Free Radic Biol Med

Mitochondrial and glucose metabolic dysfunctions in granulosa cells induce impaired oocytes of polycystic ovary syndrome through Sirtuin 3.

Authors - Qing Zhang
mouseWB

J Neurosci

A Mutation in Hnrnph1 That Decreases Methamphetamine-Induced Reinforcement, Reward, and Dopamine Release and Increases Synaptosomal hnRNP H and Mitochondrial Proteins.

Authors - Qiu T Ruan
ratWB

Cell Death Dis

Calcium sensing receptor protects high glucose-induced energy metabolism disorder via blocking gp78-ubiquitin proteasome pathway.

Authors - Yuehong Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

siting (Verified Customer) (07-13-2020)

very good signal

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse heart cells
ATP5F1 Antibody Western Blot, validation (1:1000 dilution) in mouse heart cells (Cat no:15999-1-AP)
FH

Yan (Verified Customer) (01-28-2020)

It worked very well with mouse heart tissue for western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart tissue extract
Loading...
||
New chat Able
正在加载,请稍候...