ATP5F1 Polyclonal antibody

• 

  WB analysis using 15999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15999-1-AP (ATP5F1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15999-1-AP

  WB result of ATP5F1 antibody (15999-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATP5F1 transfected HeLa cells.

• 

  WB analysis of mouse skeletal muscle using 15999-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15999-1-AP (ATP5F1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293T using 15999-1-AP

  IP result of anti-ATP5F1 (IP:15999-1-AP, 4ug; Detection:15999-1-AP 1:2000) with HEK-293T cells lysate 1600 ug.

• 

  IHC staining of human liver using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15999-1-AP (ATP5F1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15999-1-AP (ATP5F1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skin using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 15999-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of HeLa using 15999-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ATP5F1 antibody (15999-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  FC experiment of HeLa using 15999-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ATP5F1 (15999-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

ATP5F1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15999-1-AP

Publications(29)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

ATP synthase F(0) complex subunit B1, mitochondrial, ATP synthase peripheral stalk-membrane subunit b, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, ATP5F 1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HeLa cells, mouse skeletal muscle tissue, mouse liver tissue
• Positive IP detected in: HEK-293T cells
• Positive IHC detected in: human liver tissue, human brain tissue, human heart tissue, human kidney tissue, human skin tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 25 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

15999-1-AP targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8571

  Product name: Recombinant human ATP5F1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-256 aa of BC005366

  Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

• Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• Calculated Molecular Weight: 256 aa, 29 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC005366
• Gene Symbol: ATP5F1
• Gene ID (NCBI): 515
• RRID: AB_2258817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Mater; Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration; Authors - Zhuo Li
rat	WB	Proc Natl Acad Sci U S A; Evaluation of intramitochondrial ATP levels identifies G0/G1 switch gene 2 as a positive regulator of oxidative phosphorylation.; Authors - Hidetaka Kioka
mouse	WB,IHC	Part Fibre Toxicol; Transcriptomics of single dose and repeated carbon black and ozone inhalation co-exposure highlight progressive pulmonary mitochondrial dysfunction.; Authors - Quincy A Hathaway
human	WB	Free Radic Biol Med; Mitochondrial and glucose metabolic dysfunctions in granulosa cells induce impaired oocytes of polycystic ovary syndrome through Sirtuin 3.; Authors - Qing Zhang
mouse	WB	J Neurosci; A Mutation in Hnrnph1 That Decreases Methamphetamine-Induced Reinforcement, Reward, and Dopamine Release and Increases Synaptosomal hnRNP H and Mitochondrial Proteins.; Authors - Qiu T Ruan
rat	WB	Cell Death Dis; Calcium sensing receptor protects high glucose-induced energy metabolism disorder via blocking gp78-ubiquitin proteasome pathway.; Authors - Yuehong Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

siting (Verified Customer) (07-13-2020)

very good signal

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse heart cells

ATP5F1 Antibody Western Blot, validation (1:1000 dilution) in mouse heart cells (Cat no:15999-1-AP)

FH

Yan (Verified Customer) (01-28-2020)

It worked very well with mouse heart tissue for western blot.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse heart tissue extract