ATP5H Recombinant monoclonal antibody, PBS Only

ATP5H Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 86174-2-PBS
Clone No.250751G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

ATP synthase peripheral stalk subunit d, ATP5, ATP5JD, ATP5PD, ATPQ

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86174-2-PBS targets ATP5H in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11429

Product name: Recombinant human ATP5H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-137 aa of BC032245

Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d
Calculated Molecular Weight 137 aa, 16 kDa
Observed Molecular Weight 19-22 kDa
GenBank Accession NumberBC032245
Gene Symbol ATP5H
Gene ID (NCBI) 10476
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75947
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5H gene encodes ATP synthase subunit d of the Fo complex.

Loading...
||
New chat Able
正在加载,请稍候...