ATP5H Fusion Protein

Catalog number: Ag11429
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

ATP5H fusion protein Ag11429 SDS-PAGE


Product Name:
human ATP5H-GST fusion protein

Catalog No:
Ag11429

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
(1-137 aa encoded by BC032245)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top