ATP5O Polyclonal antibody

ATP5O Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 10994-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

ATP5PO, ATP synthase peripheral stalk subunit OSCP, ATPO, OSCP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse placenta tissue, mouse liver tissue, mouse heart tissue, mouse colon tissue, Caco-2 cells, HCT116 cells, HEK-293 cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue, human testis tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10994-1-AP targets ATP5O in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1458

Product name: Recombinant human ATP5O protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-213 aa of BC021233

Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23-25 kDa
GenBank Accession NumberBC021233
Gene Symbol ATP5O
Gene ID (NCBI) 539
RRIDAB_2062063
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48047
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5O(ATP synthase subunit O, mitochondrial) is also named as ATPO, OSCP and belongs to the ATPase delta chain family. The gene encodes the oligomycin sensitivity-conferring protein (OSCP) of ATP synthase. The predicted polypeptide is 213 amino acids long with more than 80% identity to the bovine and mouse homologs and it is expressed at highest levels in muscle and heart by the northern blot(PMID:7490082). Many studies have indicated that mitochondrial dysfunction is central to the development of most age-related human diseases including neurodegenerative diseases, cancer, and type 2 diabetes.

Protocols

Product Specific Protocols
FC protocol for ATP5O antibody 10994-1-APDownload protocol
IHC protocol for ATP5O antibody 10994-1-APDownload protocol
WB protocol for ATP5O antibody 10994-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancers (Basel)

Proteomic Analysis Identifies NDUFS1 and ATP5O as Novel Markers for Survival Outcome in Prostate Cancer.

Authors - Robert Wiebringhaus
humanWB

Neural Regen Res

CHCHD2 Thr61Ile mutation impairs F1F0-ATPase assembly in in vitro and in vivo models of Parkinson's disease

Authors - Xiang Chen
humanWB

Brain Pathol

Fatal familial insomnia: mitochondrial and protein synthesis machinery decline in the mediodorsal thalamus.

Authors - Margalida A Frau-Méndez
humanWB

J Mol Biol

COA6 Facilitates Cytochrome c Oxidase Biogenesis as Thiol-reductase for Copper Metallochaperones in Mitochondria.

Authors - David Pacheu-Grau
humanWB

Dis Markers

CYC1 Predicts Poor Prognosis in Patients with Breast Cancer.

Authors - Yingyan Han

Oncol Lett

Lentivirus-mediated silencing of MPHOSPH8 inhibits MTC proliferation and enhances apoptosis.

Authors - Peiyong Li
Loading...
||
New chat Able
正在加载,请稍候...