ATP5O Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATP5O Polyclonal antibody (10994-1-AP)

ATP5O Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10994-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

ATP5PO, ATP synthase peripheral stalk subunit OSCP, ATPO, OSCP

• 

  WB analysis using 10994-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10994-1-AP (ATP5O antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 10994-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 10994-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 10994-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 10994-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 10994-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug ATP5O Polyclonal antibody (10994-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATP5O in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse placenta tissue, mouse liver tissue, mouse heart tissue, mouse colon tissue, Caco-2 cells, HCT116 cells, HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human testis tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10994-1-AP targets ATP5O in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1458

  Product name: Recombinant human ATP5O protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC021233

  Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

• Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC021233
• Gene Symbol: ATP5O
• Gene ID (NCBI): 539
• RRID: AB_2062063
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48047
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5O(ATP synthase subunit O, mitochondrial) is also named as ATPO, OSCP and belongs to the ATPase delta chain family. The gene encodes the oligomycin sensitivity-conferring protein (OSCP) of ATP synthase. The predicted polypeptide is 213 amino acids long with more than 80% identity to the bovine and mouse homologs and it is expressed at highest levels in muscle and heart by the northern blot(PMID:7490082). Many studies have indicated that mitochondrial dysfunction is central to the development of most age-related human diseases including neurodegenerative diseases, cancer, and type 2 diabetes.

Publications

What published studies show

The ATP5O Polyclonal antibody (Cat# 10994-1-AP) has 11 citations published in journals including NPJ Parkinson's Disease, Neural Regen Res, Free Radic Biol Med, Front Cell Dev Biol, Brain Pathol, Cancers, J Mol Biol, Eur J Nutr, Front Oncol, Oncol Lett, and Dis Markers. Research fields span Parkinson's disease, mitochondrial dysfunction, oxidative phosphorylation, diabetes, exercise metabolism, fatal familial insomnia, prostate cancer, mitochondrial biogenesis, metabolic reprogramming, and breast cancer.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	NPJ Parkinsons Dis; Enhancing mitochondrial proteolysis alleviates alpha-synuclein-mediated cellular toxicity; Authors - Xi Zhang
human	WB	Neural Regen Res; CHCHD2 Thr61Ile mutation impairs F1F0-ATPase assembly in in vitro and in vivo models of Parkinson's disease; Authors - Xiang Chen
mouse	WB	Free Radic Biol Med; Low-intensity pulsed ultrasound ameliorates pancreatic injury and glucose metabolism in type 2 diabetic mice: regulatory role of the oxidative phosphorylation pathway.; Authors - Chen Ni
mouse	WB	Front Cell Dev Biol; Multi-omics study on the effect of moderate-intensity exercise on protein lactylation in mouse muscle tissue; Authors - Jiahui Chang
human	WB	Brain Pathol; Fatal familial insomnia: mitochondrial and protein synthesis machinery decline in the mediodorsal thalamus.; Authors - Margalida A Frau-Méndez
human	IHC	Cancers (Basel); Proteomic Analysis Identifies NDUFS1 and ATP5O as Novel Markers for Survival Outcome in Prostate Cancer.; Authors - Robert Wiebringhaus