• Featured Product
  • KD/KO Validated

ATP6V1E1 Polyclonal antibody

ATP6V1E1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 15280-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

ATP6E, ATP6E2, ATP6V1E, ATP6V1E1, P31, V ATPase 31 kDa subunit, V ATPase subunit E 1, Vma4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human liver tissue, human brain tissue, mouse brain tissue, HEK-293 cells
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse testis tissue, human testis tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15280-1-AP targets ATP6V1E1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7399

Product name: Recombinant human ATP6V1E1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-226 aa of BC004443

Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Predict reactive species
Full Name ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC004443
Gene Symbol ATP6V1E1
Gene ID (NCBI) 529
RRIDAB_2062545
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP36543
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP6V1E1, also named as ATP6E, ATP6E2 and p31, belongs to the V-ATPase E subunit family. It is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase and the lack of mycobacterial phagosome acidification are directly attributed to the Mtb protein tyrosine phosphatase PtpA.

Protocols

Product Specific Protocols
WB protocol for ATP6V1E1 antibody 15280-1-APDownload protocol
IHC protocol for ATP6V1E1 antibody 15280-1-APDownload protocol
IP protocol for ATP6V1E1 antibody 15280-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Proc Natl Acad Sci U S A

Mycobacterium tuberculosis protein tyrosine phosphatase (PtpA) excludes host vacuolar-H+-ATPase to inhibit phagosome acidification.

Authors - Wong Dennis D
  • KO Validated

J Biol Chem

The ROGDI protein mutated in Kohlschutter-Tonz syndrome is a novel subunit of the Rabconnectin-3 complex implicated in V-ATPase assembly

Authors - Samuel R Winkley
humanWB

J Cell Sci

Neutral sphingomyelinase 2 controls exosome secretion by counteracting V-ATPase-mediated endosome acidification.

Authors - Dolma Choezom
pigWB

Microorganisms

Exopolysaccharides from Bifidobacterium animalis Ameliorate Escherichia coli-Induced IPEC-J2 Cell Damage via Inhibiting Apoptosis and Restoring Autophagy.

Authors - Lanxin Yuan
humanWB, IHC

J Proteomics

iTRAQ-based quantitative proteomic analysis for identification of oligodendroglioma biomarkers related with loss of heterozygosity on chromosomal arm 1p.

Authors - Yang Liu-song LS
humanWB

Vet Res

Butyrate-mediated autophagy inhibition limits cytosolic Salmonella Infantis replication in the colon of pigs treated with a mixture of Lactobacillus and Bacillus.

Authors - Bingxin Chu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sven (Verified Customer) (04-14-2022)

Works very well on western blot for mouse tissue (1:1000 dilution in TBS-T with 5% BSA, 0.02% NaN3).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 dilution
  • Cell Tissue Type: Mouse Embryonic Fibroblasts (MEFs)
ATP6V1E1 Antibody Western Blot validation (1:1000 dilution dilution) in Mouse Embryonic Fibroblasts (MEFs) (Cat no:15280-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...