ATRAID Polyclonal antibody

• 

  WB analysis of mouse brain using 25548-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25548-1-AP (ATRAID antibody at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse kidney using 25548-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25548-1-AP (ATRAID antibody at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of HEK-293 using 25548-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25548-1-AP (ATRAID antibody at dilution of 1:300 incubated at 4 degree celsius over night.

ATRAID Polyclonal Antibody for WB, ELISA

Cat No. 25548-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Apoptosis related protein 3, APR 3, APR 3, APR3, C2orf28, HSPC013, p18, PRO240, UNQ214/PRO240

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HEK-293 cells, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25548-1-AP targets ATRAID in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22168

  Product name: Recombinant human C2orf28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC035850

  Sequence: MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSF

• Full Name: chromosome 2 open reading frame 28
• Calculated Molecular Weight: 229 aa, 25 kDa
• Observed Molecular Weight: 28-35 kDa
• GenBank Accession Number: BC035850
• Gene Symbol: ATRAID
• Gene ID (NCBI): 51374
• RRID: AB_2880128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UW56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATRAID, also named as APR3, p18, C2orf28, promotes osteoblast cell differentiation and terminal mineralization. It plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. This antibody recognizes all the three isoforms (20-24 kDa, 16-19 kDa and 28-30 kDa).