• Featured Product
  • KD/KO Validated

Alpha-1-Antitrypsin Monoclonal antibody

Alpha-1-Antitrypsin Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 66135-1-Ig
Clone No.1A9G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

a1-antitrypsin, Serpin A1, SERPINA1, 1A9G6, A1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, rat liver tissue, HepG2 cells, L02 cells, human saliva, pig liver tissue, human milk, mouse liver tissue, human plasma, human placenta
Positive IP detected inhuman plasma tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66135-1-Ig targets Alpha-1-Antitrypsin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9516

Product name: Recombinant human Alpha-1-Antitrypsin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 28-418 aa of BC015642

Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Calculated Molecular Weight 418 aa, 47 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC015642
Gene Symbol Alpha 1-Antitrypsin
Gene ID (NCBI) 5265
RRIDAB_2881534
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01009
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease.

Protocols

Product Specific Protocols
FC protocol for Alpha-1-Antitrypsin antibody 66135-1-IgDownload protocol
IF protocol for Alpha-1-Antitrypsin antibody 66135-1-IgDownload protocol
IHC protocol for Alpha-1-Antitrypsin antibody 66135-1-IgDownload protocol
IP protocol for Alpha-1-Antitrypsin antibody 66135-1-IgDownload protocol
WB protocol for Alpha-1-Antitrypsin antibody 66135-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Liver Int

Extensively expanded murine-induced hepatic stem cells maintain high-efficient hepatic differentiation potential for repopulation of injured livers.

Authors - Bing Yu
humanWB

Biochem J

LMAN1-MCFD2 complex is a cargo receptor for the ER-Golgi transport of α1-antitrypsin.

Authors - Yuan Zhang
humanIHC

Dis Markers

Differential Plasma Proteins Identified via iTRAQ-Based Analysis Serve as Diagnostic Markers of Pancreatic Ductal Adenocarcinoma

Authors - Xiubing Chen
humanWB,IF

Ann Transl Med

Functional hit 1 (FH1)-based rapid and efficient generation of functional hepatocytes from human mesenchymal stem cells: a novel strategy for hepatic differentiation.

Authors - Sang Luo
humanWB,IF

Ann Transl Med

Changes in the hepatic differentiation potential of human mesenchymal stem cells aged in vitro.

Authors - Sang Luo
ratWB

Res Sq

Novel Populations of Lung Capillary Endothelial Cells and Their Functional Significance

Authors - Joel James
Loading...
||
New chat Able
正在加载,请稍候...