Alpha E-Catenin Monoclonal antibody, PBS Only

Alpha E-Catenin Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 66221-1-PBS
Clone No.2B7B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

CTNNA1, 2B7B8, alpha catenin, Alpha E catenin, CAP102

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66221-1-PBS targets Alpha E-Catenin in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23603

Product name: Recombinant human CTNNA1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 188-536 aa of BC031262

Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI

Predict reactive species
Full Name catenin (cadherin-associated protein), alpha 1, 102kDa
Calculated Molecular Weight 906 aa, 100 kDa
Observed Molecular Weight 95-100 kDa
GenBank Accession NumberBC031262
Gene Symbol Alpha E-Catenin
Gene ID (NCBI) 1495
RRIDAB_2881612
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35221
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.

Loading...
||
New chat Able
正在加载,请稍候...