Alpha E-Catenin Monoclonal antibody

Alpha E-Catenin Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 66221-1-Ig
Clone No.2B7B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

CTNNA1, 2B7B8, alpha catenin, Alpha E catenin, CAP102

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells
Positive IHC detected inhuman stomach tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66221-1-Ig targets Alpha E-Catenin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23603

Product name: Recombinant human CTNNA1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 188-536 aa of BC031262

Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI

Predict reactive species
Full Name catenin (cadherin-associated protein), alpha 1, 102kDa
Calculated Molecular Weight 906 aa, 100 kDa
Observed Molecular Weight 95-100 kDa
GenBank Accession NumberBC031262
Gene Symbol Alpha E-Catenin
Gene ID (NCBI) 1495
RRIDAB_2881612
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35221
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.

Protocols

Product Specific Protocols
FC protocol for Alpha E-Catenin antibody 66221-1-IgDownload protocol
IHC protocol for Alpha E-Catenin antibody 66221-1-IgDownload protocol
WB protocol for Alpha E-Catenin antibody 66221-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Int J Mol Sci

Histological and Immunohistochemical Studies to Determine the Mechanism of Cleft Palate Induction after Palatal Fusion in Mice Exposed to TCDD.

Authors - Chisato Sakuma
humanWB

Oncotarget

YAP1 enhances cell proliferation, migration, and invasion of gastric cancer in vitro and in vivo.

Authors - Dan Sun
humanWB,IHC

Mol Med Rep

Wild-type KRAS inhibits the migration and invasion of pancreatic cancer through the Wnt/β-catenin pathway

Authors - Xianhua Hu
mouseWB

Biochem Biophys Res Commun

β2-Adrenergic receptor regulates osteoblast differentiation and migration and C-terminal β-catenin phosphorylation

Authors - Leah E Worton
Loading...
||
New chat

Able

正在加载,请稍候...