BAX Polyclonal antibody

• 

  WB analysis of MCF-7 using 23931-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 23931-1-AP (BAX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COS-7 using 23931-1-AP

  COS-7 cells were subjected to SDS PAGE followed by western blot with 23931-1-AP (BAX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW264.7 using 23931-1-AP

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 23931-1-AP (BAX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 23931-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 23931-1-AP (BAX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 23931-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23931-1-AP (BAX Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 23931-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23931-1-AP (BAX Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 23931-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23931-1-AP (BAX Antibody) at dilution of 1:50 (under 40x lens).

BAX Polyclonal Antibody for ELISA

Cat No. 23931-1-AP

Publications(50)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, ELISA

Synonyms

Apoptosis regulator BAX, BAX

---

Published Applications

• WB: See 45 publications below
• IHC: See 2 publications below

Product Information

23931-1-AP targets BAX in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21068

  Product name: Recombinant human BAX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC014175

  Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

• Full Name: BCL2-associated X protein
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC014175
• Gene Symbol: BAX
• Gene ID (NCBI): 581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07812
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Br J Pharmacol; Astaxanthin attenuates hepatic damage and mitochondrial dysfunction in non-alcoholic fatty liver disease by up-regulating the FGF21/PGC-1α pathway.; Authors - Liwei Wu
human	WB	Oncotarget; By reducing hexokinase 2, resveratrol induces apoptosis in HCC cells addicted to aerobic glycolysis and inhibits tumor growth in mice.; Authors - Weiqi Dai
human	WB	Aging (Albany NY); SRT2183 impairs ovarian cancer by facilitating autophagy.; Authors - Tingting Sun
human	WB	Int J Oncol; NT21MP negatively regulates paclitaxel-resistant cells by targeting miR‑155‑3p and miR‑155-5p via the CXCR4 pathway in breast cancer.; Authors - Yueyue Wang
human	WB	Nanoscale Res Lett; Cytotoxicity induced by nanobacteria and nanohydroxyapatites in human choriocarcinoma cells.; Authors - Mingjun Zhang
human	WB	Oncotarget; AMPK activation-dependent autophagy compromises oleanolic acid-induced cytotoxicity in human bladder cancer cells.; Authors - Yarong Song