BCKDHA Recombinant monoclonal antibody, PBS Only

BCKDHA Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 85799-3-PBS
Clone No.250051G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, BCKDH E1-alpha, Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain, EC:1.2.4.4, MSU

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85799-3-PBS targets BCKDHA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32613

Product name: Recombinant human BCKDHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 264-445 aa of BC008933

Sequence: CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK

Predict reactive species
Full Name branched chain keto acid dehydrogenase E1, alpha polypeptide
Calculated Molecular Weight 50 kDa
Observed Molecular Weight42-50 kDa
GenBank Accession NumberBC008933
Gene Symbol BCKDHA
Gene ID (NCBI) 593
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12694
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), the gene encoding the regulated subunit of BCKDC was only one of two primary susceptibility genes identified that affected the risk of both type 2 diabetes mellitus (T2DM) and obesity (PMID: 25287287). BIX01294 transcriptionally downregulated the transcription of BCKDHA, which is essential for fueling the tricarboxylic acid (TCA) cycle. Studies have shown that KDM3A, a Jumonji histone demethylase, epigenetically regulates BCKDHA expression by binding to the BCKDHA gene promoter (PMID: 34876693). Moreover, at least four genes including BCKDHA, branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), dihydrolipoamide dehydrogenase (DLD), and dihydrolipoamide branched chain transacylase E2 (DBT) have been reported to be the causative gene for Maple syrup urine disease (MSUD) (PMID: 34187135).

Loading...
||
New chat Able
正在加载,请稍候...