BCKDHA Recombinant monoclonal antibody

BCKDHA Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 85799-3-RR
Clone No.250051G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, BCKDH E1-alpha, Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain, EC:1.2.4.4, MSU

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse liver tissue, HEK-293T cells, HepG2 cells, rat liver tissue, mouse heart tissue
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85799-3-RR targets BCKDHA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32613

Product name: Recombinant human BCKDHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 264-445 aa of BC008933

Sequence: CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK

Predict reactive species
Full Name branched chain keto acid dehydrogenase E1, alpha polypeptide
Calculated Molecular Weight 50 kDa
Observed Molecular Weight42-50 kDa
GenBank Accession NumberBC008933
Gene Symbol BCKDHA
Gene ID (NCBI) 593
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12694
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), the gene encoding the regulated subunit of BCKDC was only one of two primary susceptibility genes identified that affected the risk of both type 2 diabetes mellitus (T2DM) and obesity (PMID: 25287287). BIX01294 transcriptionally downregulated the transcription of BCKDHA, which is essential for fueling the tricarboxylic acid (TCA) cycle. Studies have shown that KDM3A, a Jumonji histone demethylase, epigenetically regulates BCKDHA expression by binding to the BCKDHA gene promoter (PMID: 34876693). Moreover, at least four genes including BCKDHA, branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), dihydrolipoamide dehydrogenase (DLD), and dihydrolipoamide branched chain transacylase E2 (DBT) have been reported to be the causative gene for Maple syrup urine disease (MSUD) (PMID: 34187135).

Protocols

Product Specific Protocols
IF protocol for BCKDHA antibody 85799-3-RRDownload protocol
WB protocol for BCKDHA antibody 85799-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...