BCL6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BCL6 Polyclonal antibody (21187-1-AP)

• Featured Product
• KD/KO Validated

BCL6 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 21187-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

BCL-6, B cell CLL/lymphoma 6, B cell lymphoma 6 protein, B-cell lymphoma 5 protein, B-cell lymphoma 6 protein

• 

  WB analysis of Raji using 21187-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 21187-1-AP (BCL6 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A20 using 21187-1-AP

  A20 cells were subjected to SDS PAGE followed by western blot with 21187-1-AP (BCL6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 21187-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 21187-1-AP (BCL6 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 21187-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 21187-1-AP (BCL6 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Ramos using 21187-1-AP

  IP result of anti-BCL6 (IP:21187-1-AP, 4ug; Detection:21187-1-AP 1:5000) with Ramos cells lysate 800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 21187-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21187-1-AP (BCL6 antibody) at dilution of 1:6000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 21187-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21187-1-AP (BCL6 antibody) at dilution of 1:6000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 21187-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 21187-1-AP (BCL6 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BCL6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, A20 cells
• Positive IP detected in: Ramos cells
• Positive IHC detected in: human tonsillitis tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:3000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21187-1-AP targets BCL6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15519

  Product name: Recombinant human BCL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-532 aa of BC150184

  Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

• Full Name: B-cell CLL/lymphoma 6
• Calculated Molecular Weight: 706 aa, 79 kDa
• Observed Molecular Weight: 79-95 kDa
• GenBank Accession Number: BC150184
• Gene Symbol: BCL6
• Gene ID (NCBI): 604
• RRID: AB_2878827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41182
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCL6, a zinc finger transcription factor, contains a N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.

Publications

What published studies show

The BCL6 Polyclonal antibody (Cat# 21187-1-AP) has 23 citations across journals including Cell, Nature Neuroscience, Nature Communications, Cell Death & Disease, Journal of Autoimmunity, Biochemical Pharmacology, and Frontiers in Cell and Developmental Biology. Research fields span B-cell lymphoma, autoimmune diseases (lupus), liver disease (NAFLD), renal and gastric cancer, glioma, pulmonary fibrosis, allergic inflammation, neurodegeneration (ALS), and NF-κB signaling. Applications include WB, IHC, IP, and IF in human, mouse, and rat samples.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; YTHDF2 promotes ATP synthesis and immune evasion in B cell malignancies; Authors - Zhenhua Chen
rat	WB	Nat Neurosci; Mitochondrial respiratory complex IV deficiency recapitulates amyotrophic lateral sclerosis; Authors - Man Cheng
	IHC	Nat Commun; A truncating mutation in the autophagy gene UVRAG drives inflammation and tumorigenesis in mice.; Authors - Christine Quach
mouse,human	WB	Cell Death Dis; B-cell lymphoma 6 alleviates nonalcoholic fatty liver disease in mice through suppression of fatty acid transporter CD36.; Authors - Hao Zhang ; KD Validated
human	WB	Int J Biol Sci; Interferon Regulatory Factor 4 Recruits Immature B Cells to Signal Tertiary Lymphoid Structure Immaturity and Progression of Clear Cell Renal Cell Carcinoma; Authors - Siqi Zhou
human	WB	J Pineal Res; Melatonin Inhibits Antibody-Secreting Cells and Improves Systemic Lupus Erythematosus via Modulation of the PKA-CREB Signaling Pathway.; Authors - Pei Du