BCRP/ABCG2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 27286-1-AP

  WB result of BCRP,ABCG2 antibody (27286-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCRP,ABCG2 transfected MCF-7 cells.

• 

  WB analysis using 27286-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27286-1-AP (BCRP,ABCG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 27286-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27286-1-AP (BCRP,ABCG2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27286-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27286-1-AP (BCRP,ABCG2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27286-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27286-1-AP (BCRP,ABCG2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27286-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27286-1-AP (BCRP,ABCG2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

BCRP/ABCG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27286-1-AP

Publications(69)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

ABCG2, BCRP, BCRP,ABCG2, ABC15, ABCP

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, MCF-7 cells, SGC-7901 cells, mouse brain tissue
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 61 publications below
• IHC: See 16 publications below
• IF: See 5 publications below

Product Information

27286-1-AP targets BCRP/ABCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25911

  Product name: Recombinant human BCRP,ABCG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 557-630 aa of BC021281

  Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 2
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC021281
• Gene Symbol: ABCG2
• Gene ID (NCBI): 9429
• RRID: AB_2880830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Drug Resist Updat; Cell membrane-camouflaged bufalin targets NOD2 and overcomes multidrug resistance in pancreatic cancer; Authors - Wei Zhang
mouse,human	WB,IHC	Mol Cancer; Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer.; Authors - Jianyou Gu
mouse,human	WB,IHC	PLoS Biol; A novel TOX3-WDR5-ABCG2 signaling axis regulates the progression of colorectal cancer by accelerating stem-like traits and chemoresistance; Authors - Jiaojiao Hao
human	WB	Cancer Lett; Lovastatin/SN38 co-loaded liposomes amplified ICB therapeutic effect via remodeling the immunologically-cold colon tumor and synergized stimulation of cGAS-STING pathway; Authors - Yi Yang
mouse,human	WB,IHC	Mol Ther; CRISPR-mediated MECOM depletion retards tumor growth by reducing cancer stem cell properties in lung squamous cell carcinoma.; Authors - Yuanyuan Ma
mouse	WB	Phytomedicine; Amelioration effects of α-viniferin on hyperuricemia and hyperuricemia-induced kidney injury in mice; Authors - Xiao-Li Guo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marina (Verified Customer) (07-24-2024)

Incubation with primary antibody ON at 4 C. Incubation with secondary antibody (rabbit) 2h at RT.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human cell lines

FH

Caitlin (Verified Customer) (07-12-2024)

The antibody worked well in that there was minimal background staining. However, the protein shows as multiple bands. Although, this is possibly due to a protein preparation issue rather than an antibody issue

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: A2780

FH

Udesh (Verified Customer) (09-12-2022)

Used in Western Blot at 1:3000 Dilution and it detected a band at 75 kDa.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: U2OS Osteosarcoma cells

BCRP/ABCG2 Antibody Western Blot validation (1:3000 dilution) in U2OS Osteosarcoma cells (Cat no:27286-1-AP)