Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, MCF-7 cells, SGC-7901 cells, mouse brain tissue |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27286-1-AP targets BCRP/ABCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species |
| Full Name | ATP-binding cassette, sub-family G (WHITE), member 2 |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 68-72 kDa |
| GenBank Accession Number | BC021281 |
| Gene Symbol | ABCG2 |
| Gene ID (NCBI) | 9429 |
| RRID | AB_2880830 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UNQ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCRP/ABCG2 antibody 27286-1-AP | Download protocol |
| WB protocol for BCRP/ABCG2 antibody 27286-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BCRP/ABCG2 Polyclonal antibody (Cat# 27286-1-AP) has 104 citations. These appear in journals including Molecular Cancer, Drug Resistance Updates, Cell Death & Disease, Journal of Ethnopharmacology, Food & Function, Pharmacological Research, Cancer Letters, and Scientific Reports. Research fields center on cancer and multidrug resistance (breast, colorectal, lung, prostate, liver), hyperuricemia/gout and uric acid transport, renal injury, and cancer stemness. Applications are mainly Western blot, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Mol Cancer Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer. | ||
Bioact Mater Engineering multifunctional chitosan-based hydrogels for integrated antimicrobial therapy and endogenous stem cell-driven tissue repair in infectious keratitis. | ||
Drug Resist Updat YTHDF2-mediated m6A modification of ONECUT2 promotes stemness and oxaliplatin resistance in gastric cancer through transcriptionally activating TFPI | ||
Drug Resist Updat Cell membrane-camouflaged bufalin targets NOD2 and overcomes multidrug resistance in pancreatic cancer | ||
Drug Resist Updat AMPKα2 attenuates doxorubicin induced ferroptosis by promoting NCOA4 degradation in triple negative breast cancer. | ||
Theranostics CD146(+) pericyte-like lung cancer brain metastatic stem cells promote tumor angiogenesis through dual regulatory effects on the VEGF/VEGFR axis. |
Reviews
What customers say
All five reviews are for Western Blot applications, with dilutions ranging from 1:500 to 1:3000. Three reviewers rated the antibody 5 stars, praising its strong performance, minimal background staining, and clear detection of a 75 kDa band in human cell lines and organoids. Two reviewers gave 3 stars; one noted multiple bands, though they attributed this to a possible protein preparation issue rather than the antibody itself. Overall, users report reliable specificity and low background, with the antibody performing well across various human cell types including SW620, SW480, A2780, and U2OS.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | Very good antibody
|
Yogain (Verified Customer) (12-19-2025) | Antibody works really well for western blot.
|
Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4 C. Incubation with secondary antibody (rabbit) 2h at RT.
|
Caitlin (Verified Customer) (07-12-2024) | The antibody worked well in that there was minimal background staining. However, the protein shows as multiple bands. Although, this is possibly due to a protein preparation issue rather than an antibody issue
|
Udesh (Verified Customer) (09-12-2022) | Used in Western Blot at 1:3000 Dilution and it detected a band at 75 kDa.
 |
