Recombinant human BOP1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag26669
Synonyms
BOP1, block of proliferation 1, KIAA0124
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT
(1-135 aa encoded by BC013787) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
