• Featured Product
  • KD/KO Validated

Bcl2 Polyclonal antibody

Bcl2 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 26593-1-AP
Publications(1131)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (7)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA

Bcl-2, B cell leukemia/lymphoma 2, Bcl 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, C2C12 cells, mouse brain tissue, mouse heart tissue, mouse testis tissue, mouse kidney tissue, mouse spleen tissue, rat spleen tissue, rat spleen tissue., rat kidney tissue, rat testis tissue, mouse colon tissue
Positive IHC detected inmouse spleen tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26593-1-AP targets Bcl2 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Cited Reactivitymouse, rat, pig, rabbit, canine, chicken, bovine, hamster, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24260

Product name: Recombinant mouse Bcl2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of NM-009741

Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell leukemia/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberNM-009741
Gene Symbol Bcl2
Gene ID (NCBI) 12043
RRIDAB_2818996
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10417
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1.       What is Bcl-2?

Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.

2.       FAQs for Bcl-2

  1.  How to measure Bcl-2 and Bax apoptotic markers by western blotting

    Generally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.

  2. What band size should I expect in western blotting for Bcl-2?

    The molecular weight of Bcl-2 is 26 kDa.


Protocols

Product Specific Protocols
IHC protocol for Bcl2 antibody 26593-1-APDownload protocol
WB protocol for Bcl2 antibody 26593-1-APDownload protocol
IF protocol for Bcl2 antibody 26593-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

ACS Nano

Dual Strategies Based on Golgi Apparatus/Endoplasmic Reticulum Targeting and Anchoring for High-Efficiency siRNA Delivery and Tumor RNAi Therapy

Authors - Yashi Wang
  • KD Validated

ACS Nano

Melatonin-Derived Carbon Dots with Free Radical Scavenging Property for Effective Periodontitis Treatment via the Nrf2/HO-1 Pathway

Authors - Xirui Xin
mouseWB

Acta Pharm Sin B

Honokiol alleviated neurodegeneration by reducing oxidative stress and improving mitochondrial function in mutant SOD1 cellular and mouse models of amyotrophic lateral sclerosis

Authors - Yujun Zhou

Cell Rep Med

Microneedle delivery of CAR-M-like engineered macrophages alleviates intervertebral disc degeneration through enhanced efferocytosis capacity

Authors - Xingyu Zhou
mouseWB

Redox Biol

FUT2-dependent fucosylation of HYOU1 protects intestinal stem cells against inflammatory injury by regulating unfolded protein response

Authors - Zhe Wang
mouseWB

Redox Biol

Protective role of vitamin D receptor against mitochondrial calcium overload from PM2.5-Induced injury in renal tubular cells

Authors - Mengqiu Lu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Charlotte (Verified Customer) (08-15-2024)

The fainter band at the bottom of the membrane corresponds to the expected MW. Done in milk

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: NIH-3T3
Bcl2 Antibody Western Blot validation (1/1000 dilution) in NIH-3T3 (Cat no:26593-1-AP)
FH

Anna (Verified Customer) (10-04-2022)

Promising staining. I have a problem with attaching a photo file. Please check the file below. https://drive.google.com/file/d/15d3t6thx7rcWyN-_DkkKCtpAMyi8jxHO/view

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 500
  • Cell Tissue Type: brain frozen sections - mouse
FH

PRADEEP (Verified Customer) (11-03-2020)

Giving very good result for IF.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse muscle
Loading...
||
New chat Able
正在加载,请稍候...