Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells |
| Positive IHC detected in | human stomach tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66665-1-Ig targets Beclin 1 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, hamster, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1843 Product name: Recombinant human Beclin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 141-450 aa of BC010276 Sequence: TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK Predict reactive species |
| Full Name | beclin 1, autophagy related |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52-60 kDa |
| GenBank Accession Number | BC010276 |
| Gene Symbol | Beclin 1 |
| Gene ID (NCBI) | 8678 |
| RRID | AB_2882020 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14457 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beclin 1, also known as ATG6 or VPS30, interacts with various cofactors (e.g. Ambra1, Barkor (Atg14), Rubicon, or UVRAG) to regulate the lipid kinase Vps34 and promote the formation of the BECLIN1-Vps34-Vps15 complex, hence inducing autophagy. Its function (via the BH3 domain) is inhibited by Bcl-2 or Bcl-XL. Beclin 1 (BECN1) is a crucial molecule in the control of the autophagic activity, and its activity is regulated by multiple mechanisms, including the post-translational modification, protein-protein interaction, and subcellular localization. It plays a role in crosstalk between apoptosis and autophagy. It has been reported that Beclin 1 can be cleaved into fragments of 50, 37 and 35 kDa during apoptosis. It is involved in many disorders, including neurodegeneration and cancer (tumorigenesis). Beclin 1 is a mammalian tumor suppressor, and its gene is monoallelically deleted in 75% of ovarian, 50% of breast, and 40% of prostate cancers. Decreased expression of Beclin 1 has also been observed in human brain and lung tumors. The level of Beclin 1 was decreased in the affected brain regions of patients with Alzheimer's disease early in the disease process. Recent studies have also shown that gain and loss of Beclin 1 function affects the death of heart cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| IHC protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| WB protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Beclin 1 antibody (Cat# 66665-1-Ig) has 157 total citations published in journals including Autophagy, Nature Communications, Gastroenterology, Cell Death & Differentiation, Hepatology, International Journal of Biological Sciences, and International Immunopharmacology. Associated research fields encompass autophagy and mitophagy regulation, cancer biology, neuroscience, cardiovascular disease, immunology, ferroptosis, diabetes, and hepatic pathology. The antibody is primarily used for Western blot, with additional applications in immunofluorescence, immunohistochemistry, and co-immunoprecipitation across human, mouse, rat, and other species.
| Species | Application | Title |
|---|---|---|
Gastroenterology Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells | ||
Cell Mol Immunol Dynamic regulation of TBK1 lactylation shapes antiviral immune responses. | ||
Bioact Mater Injectable cartilage matrix hydrogel loaded with cartilage endplate stem cells engineered to release exosomes for non-invasive treatment of intervertebral disc degeneration. | ||
Autophagy PSAT1 inhibits mTORC1 activation by preventing Rag heterodimer formation in lung adenocarcinoma | ||
Autophagy Bunyavirus SFTSV NSs utilizes autophagy to escape the antiviral innate immune response | ||
Autophagy S-palmitoylation coordinates the trafficking of ATG9A to mediate autophagy initiation |
Reviews
What customers say
One reviewer rated this antibody 4/5 stars, using it at a 1:1000 dilution for Western Blot on human lung cancer cell lines (NSCLC). They reported that the antibody works well after overnight incubation on whole cell lysates. Overall, the feedback is positive, confirming reliable performance in WB applications with human cancer cell line samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nikolett (Verified Customer) (11-26-2025) | Antibody works well after overnight incubation as 1:1000 on whole cell lysates of NSCLC cell lines.
|
