• KD/KO Validated

Beclin 1 Monoclonal antibody, PBS Only (Capture)

Beclin 1 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66665-1-PBS
Clone No.1C10C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

BECN1, 1C10C4, ATG 6, ATG6, Beclin1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66665-1-PBS targets Beclin 1 as part of a matched antibody pair:

MP51448-1: 66665-1-PBS capture and 66665-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1843

Product name: Recombinant human Beclin 1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 141-450 aa of BC010276

Sequence: TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Predict reactive species
Full Name beclin 1, autophagy related
Calculated Molecular Weight 52 kDa
Observed Molecular Weight52-60 kDa
GenBank Accession NumberBC010276
Gene Symbol Beclin 1
Gene ID (NCBI) 8678
RRIDAB_2882020
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14457
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Beclin 1, also known as ATG6 or VPS30, interacts with various cofactors (e.g. Ambra1, Barkor (Atg14), Rubicon, or UVRAG) to regulate the lipid kinase Vps34 and promote the formation of the BECLIN1-Vps34-Vps15 complex, hence inducing autophagy. Its function (via the BH3 domain) is inhibited by Bcl-2 or Bcl-XL. Beclin 1 (BECN1) is a crucial molecule in the control of the autophagic activity, and its activity is regulated by multiple mechanisms, including the post-translational modification, protein-protein interaction, and subcellular localization. It plays a role in crosstalk between apoptosis and autophagy. It has been reported that Beclin 1 can be cleaved into fragments of 50, 37 and 35 kDa during apoptosis. It is involved in many disorders, including neurodegeneration and cancer (tumorigenesis). Beclin 1 is a mammalian tumor suppressor, and its gene is monoallelically deleted in 75% of ovarian, 50% of breast, and 40% of prostate cancers. Decreased expression of Beclin 1 has also been observed in human brain and lung tumors. The level of Beclin 1 was decreased in the affected brain regions of patients with Alzheimer's disease early in the disease process. Recent studies have also shown that gain and loss of Beclin 1 function affects the death of heart cells.

Loading...
||
New chat

Able

正在加载,请稍候...