Tested Applications
Positive WB detected in | U2OS cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:150-1:600 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
CoIP | See 1 publications below |
Product Information
27382-1-AP targets C19orf12 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26555 Product name: Recombinant human C19orf12 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-107 aa of BC063518 Sequence: MTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRPCSSSCWPCW Predict reactive species |
Full Name | chromosome 19 open reading frame 12 |
Calculated Molecular Weight | 107 aa, 11 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC063518 |
Gene Symbol | C19orf12 |
Gene ID (NCBI) | 83636 |
RRID | AB_2880858 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NSK7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C19orf12 antibody 27382-1-AP | Download protocol |
IHC protocol for C19orf12 antibody 27382-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Free Radic Biol Med C19orf12 ablation causes ferroptosis in mitochondrial membrane protein-associated with neurodegeneration. | ||
Stem Cell Res Generation of four human induced pluripotent stem cell lines derived from patients with MPAN, subtype of NBIA, carrying the c.204_214del11 mutation in the C19orf12 gene | ||
Cell Rep C19orf12 inhibits mitochondrial function and enhances the antitumor effects of metformin in non-small cell lung cancer
|