C1QTNF3 Polyclonal antibody, PBS Only

• 

  IHC staining of human kidney using 11414-1-AP (same clone as 11414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11414-1-AP (C1QTNF3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11414-1-AP (same clone as 11414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11414-1-AP (C1QTNF3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 11414-1-AP (same clone as 11414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 11414-1-AP (C1QTNF3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 11414-1-AP (same clone as 11414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 11414-1-AP (C1QTNF3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11414-1-PBS in a different storage buffer formulation.

C1QTNF3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 11414-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

11414-1-PBS targets C1QTNF3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1958

  Product name: Recombinant human C1QTNF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-246 aa of BC016021

  Sequence: IAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAEGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

• Full Name: C1q and tumor necrosis factor related protein 3
• Calculated Molecular Weight: 319 aa, 35 kDa
• GenBank Accession Number: BC016021
• Gene Symbol: C1QTNF3
• Gene ID (NCBI): 114899
• RRID: AB_2877763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXJ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.