Recombinant human C1orf84 protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag23572
Synonyms
C1orf84, SZT2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLSHLHQTVQATPQEMLLQSEQELEVLSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDEVFHALSRCLGGLLRPFRVPGSCIDFQPEIYVTIQAYSSIIGLQSHQ
(1-166 aa encoded by BC051343) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
