SYNDIG1 Polyclonal antibody

• 

  WB analysis of mouse heart using 27537-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27537-1-AP (SYNDIG1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 27537-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27537-1-AP (SYNDIG1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 27537-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27537-1-AP (SYNDIG1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 27537-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27537-1-AP (SYNDIG1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 27537-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27537-1-AP (SYNDIG1 antibody) at dilution of 1:200 (under 40x lens).

SYNDIG1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27537-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

C20orf39, Dispanin subfamily C member 2, DSPC2, Synapse differentiation-inducing gene protein 1, TMEM90B

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IHC detected in: human brain tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

27537-1-AP targets SYNDIG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26442

  Product name: Recombinant human C20orf39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC030637

  Sequence: MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMM

• Full Name: chromosome 20 open reading frame 39
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC030637
• Gene Symbol: SYNDIG1
• Gene ID (NCBI): 79953
• RRID: AB_2880900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7V2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharmacol Sin; mTOR regulates cocaine-induced behavioural sensitization through the SynDIG1-GluA2 interaction in the nucleus accumbens.; Authors - Hong-Chun Li
mouse	WB,IF	Neuropharmacology; Synapse differentiation-induced gene 1 regulates stress-induced depression through interaction with the AMPA receptor GluA2 subunit of nucleus accumbens in male mice; Authors - Linhong Jiang