HIG2 Polyclonal antibody

• 

  WB analysis using 15587-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15587-1-AP (HIG2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 15587-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15587-1-AP (HIG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 15587-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using HIG2 antibody (15587-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HIG2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15587-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C7orf68, HIG 2, HIG-2, HILPDA, Hypoxia-inducible gene 2 protein

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15587-1-AP targets HIG2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7829

  Product name: Recombinant human C7orf68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC001863

  Sequence: MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM

• Full Name: chromosome 7 open reading frame 68
• Calculated Molecular Weight: 7 kDa
• Observed Molecular Weight: 7-10 kDa
• GenBank Accession Number: BC001863
• Gene Symbol: C7orf68
• Gene ID (NCBI): 29923
• RRID: AB_3669213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5L2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HIG2 (Hypoxia inducible gene 2), also known as hypoxia inducible lipid droplet associated (HILPDA), is a gene that plays a significant role in the context of hypoxia, particularly in cancer biology. HIG2 is can be induced by hypoxia and glucose deprivation. It is expressed under low-oxygen conditions, which are common in the tumor microenvironment, and has been identified as a target gene of hypoxia-inducible factor-1 (HIF-1). HIG2 is implicated in the development and progression of various types of cancer, including renal cell carcinoma(PMID: 15930302), cell lymphoma(PMID: 26757780), epithelial ovarian cancer(PMID: 20134266), and uterine cancer(PMID: 21614900). Its expression is often elevated in these cancers and is associated with poor prognosis.