MUC1/CA15-3 C-terminal Polyclonal antibody

• 

  WB analysis using 23614-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23614-1-AP (MUC1/CA15-3 C-terminal antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 23614-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23614-1-AP (MUC1/CA15-3 C-terminal antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 23614-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23614-1-AP (MUC1/CA15-3 C-terminal antibody) at dilution of 1:200 (under 10x lens). Proteolytic pre-treatment mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 23614-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 23614-1-AP (MUC1/CA15-3 C-terminal antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 23614-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 23614-1-AP (MUC1/CA15-3 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

MUC1/CA15-3 C-terminal Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23614-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

CA15 3, CA153, CA15-3, Carcinoma associated mucin, CD227, EMA, Episialin, H23AG, KL-6, MAM6, MUC 1, MUC1, MUC1 beta, MUC1 CT, MUC1 NT, MUC1/CA15-3 C-terminal, Mucin 1, Peanut reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin, PUM, Tumor associated mucin

---

Tested Applications

• Positive WB detected in: DU 145 cells, PC-3 cells, BxPC-3 cells, MCF-7 cells
• Positive IHC detected in: human pancreas cancer tissue, human tonsillitis tissue, human breast cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 11 publications below
• IHC: See 4 publications below
• IF: See 3 publications below
• FC: See 1 publications below
• CoIP: See 1 publications below

Product Information

23614-1-AP targets MUC1/CA15-3 C-terminal in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20366

  Product name: Recombinant human CA15-3,MUC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1055-1255 aa of BC120975

  Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

• Full Name: mucin 1, cell surface associated
• Calculated Molecular Weight: 1264 aa, 123 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC120975
• Gene Symbol: MUC1/CA15-3
• Gene ID (NCBI): 4582
• RRID: AB_2879304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,FC	ACS Sens; Rolling Circle Amplification-Assisted Flow Cytometry Approach for Simultaneous Profiling of Exosomal Surface Proteins.; Authors - Xiaoyi Gao
human	WB	Cell Cycle; LINC02535/miR-30a-5p/GALNT3 axis contributes to lung adenocarcinoma progression via the NF- κ B signaling pathway.; Authors - Yue Li
human	WB	Sci Rep; Long-term expansion of basal cells and the novel differentiation methods identify mechanisms for switching Claudin expression in normal epithelia; Authors - Akihito Inoko
human	WB	Pathol Res Pract; MUC1 promotes cancer stemness and predicts poor prognosis in osteosarcoma; Authors - Jian Liu ; KD Validated
mouse	WB	Cell Death Discov; Loss of QKI in macrophage aggravates inflammatory bowel disease through amplified ROS signaling and microbiota disproportion.; Authors - Wenwen Wang
human	WB,IHC	Cell Death Discov; Silencing of lncRNA MALAT1 facilitates erastin-induced ferroptosis in endometriosis through miR-145-5p/MUC1 signaling.; Authors - Zongwen Liang