Tested Applications
| Positive WB detected in | Jurkat cells, fetal human brain tissue, HeLa cells, PC-3 cells, RAW 264.7 cells |
| Positive IP detected in | PC-3 cells |
| Positive IHC detected in | human prostate cancer tissue, human tonsillitis tissue, human rectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11549-1-AP targets CAMKK2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, monkey, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2093 Product name: Recombinant human CAMKK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC026060 Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF Predict reactive species |
| Full Name | calcium/calmodulin-dependent protein kinase kinase 2, beta |
| Calculated Molecular Weight | 588 aa, 60 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC026060 |
| Gene Symbol | CAMKK2 |
| Gene ID (NCBI) | 10645 |
| RRID | AB_2259441 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RR4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CAMKK2 antibody 11549-1-AP | Download protocol |
| IHC protocol for CAMKK2 antibody 11549-1-AP | Download protocol |
| IP protocol for CAMKK2 antibody 11549-1-AP | Download protocol |
| WB protocol for CAMKK2 antibody 11549-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CAMKK2 Polyclonal Antibody (Cat# 11549-1-AP) has 68 citations published in journals including Nature, Cell Metabolism, Nature Communications, EMBO Journal, Cell Research, and Cancer Discovery. Research fields encompass AMPK signaling, metabolic regulation, cancer biology, autophagy, ferroptosis, diabetes, mitochondrial dysfunction, lipid metabolism, renal injury, and neuroprotection. Primary applications are Western blot, with additional use in IF, IHC, and CoIP.
| Species | Application | Title |
|---|---|---|
Cell Metab AMPKα2 signals amino acid insufficiency to inhibit protein synthesis.
| ||
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Cell Res Mannose antagonizes GSDME-mediated pyroptosis through AMPK activated by metabolite GlcNAc-6P | ||
Cancer Discov Macropinocytosis in Cancer-Associated Fibroblasts Is Dependent on CaMKK2/ARHGEF2 Signaling and Functions to Support Tumor and Stromal Cell Fitness.
| ||
Autophagy m6A mRNA methylation regulates testosterone synthesis through modulating autophagy in Leydig cells. |
Reviews
What customers say
Both reviewers report positive results with this CAMKK2 antibody in Western Blot applications. One user (5/5) confirmed reliable performance on mouse tissue samples for both WB and IHC at a 1:2000 dilution. The other (4/5) used it on HEK293 cells at 1:1000 and noted that while some non-specific signals appeared, they did not significantly interfere with target detection. Overall, users find the antibody effective for its intended applications with minor background issues in cell culture contexts.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gaurav (Verified Customer) (02-27-2026) | Works with tissue samples
|
JIN-FENG (Verified Customer) (10-01-2025) | The CAMKK2 antibody performed well in my experiment. Although it showed some non-specific signals, they didn’t significantly interfere with detection of my target
 |
