Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, HeLa cells |
| Positive IHC detected in | human breast cancer tissue, mouse liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66470-2-Ig targets Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, plant |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25029 Product name: Recombinant human CASP3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-176 aa of BC016926 Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS Predict reactive species |
| Full Name | caspase 3, apoptosis-related cysteine peptidase |
| Calculated Molecular Weight | 277 aa, 32 kDa |
| Observed Molecular Weight | 32-35 kDa, 19 kDa, 17 kDa |
| GenBank Accession Number | BC016926 |
| Gene Symbol | Caspase 3 |
| Gene ID (NCBI) | 836 |
| RRID | AB_2876892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P42574 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| IHC protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| WB protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Caspase 3/P17/P19 monoclonal antibody (clone 2G4B2), catalog number 66470-2-Ig, has accumulated 479 citations. Publications appear in high-impact journals including Cancer Cell, Nature Communications, Science Advances, Cell Death & Differentiation, Biomaterials, Small, Free Radical Biology and Medicine, Advanced Science, and Journal of Controlled Release. Research fields span apoptosis and programmed cell death, neurodegeneration, oncology, cardiovascular disease, hepatology, nephrology, inflammation, mitochondrial biology, oxidative stress, stem cell therapy, nanomedicine, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Ketogenic diet inhibits glioma progression by promoting gut microbiota-derived butyrate production. | ||
J Extracell Vesicles A simple polydopamine-based platform for engineering extracellular vesicles with brain-targeting peptide and imaging probes to improve stroke outcome | ||
Transl Neurodegener CD2AP deficiency aggravates Alzheimer's disease phenotypes and pathology through p38 MAPK activation | ||
Nat Commun BNC1 deficiency-triggered ferroptosis through the NF2-YAP pathway induces primary ovarian insufficiency | ||
Nat Commun PVC microplastics facilitate uropathogenic Escherichia coli pathogenicity by enhancing host cell invasion and mitochondrial-dependent pyroptosis. |
Reviews
What customers say
One reviewer (K. Pang) rated this antibody 5/5 stars for Western Blot at a 1:500 dilution on human liver cells. They reported that the antibody works well for detecting proteins from human, rat, and mouse samples, indicating broad cross-reactivity across species.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
K. (Verified Customer) (10-26-2023) | This Ab is working good for human, rat and mouse proteins samples.
|
