Caspase 3/P17/P19 Monoclonal antibody

• 

  WB analysis of HEK-293 using 66470-2-Ig

  WB result of Caspase 3 antibody (66470-2-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Caspase 3 transfected HEK-293 cells.

• 

  WB analysis of Jurkat using 66470-2-Ig

  Untreated and Staurosporine treated Jurkat cells were subjected to SDS PAGE followed by western blot with 66470-2-Ig (CASP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66470-2-Ig

  WB result of Caspase 3/P17/P19 antibody (66470-2-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Caspase 3/P17/P19 transfected HeLa cells.

• 

  WB analysis using 66470-2-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66470-2-Ig (Caspase 3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66470-2-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66470-2-Ig (CASP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66470-2-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66470-2-Ig (CASP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66470-2-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66470-2-Ig (CASP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66470-2-Ig

  Untreated and Staurosporine treated Jurkat cells were subjected to SDS PAGE followed by western blot with 66470-2-Ig (CASP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66470-2-Ig (CASP3 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66470-2-Ig (CASP3 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66470-2-Ig (Caspase 3 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66470-2-Ig (Caspase 3 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66470-2-Ig (Caspase 3 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 66470-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66470-2-Ig (Caspase 3 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66470-2-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Caspase 3/p17/p19 antibody (66470-2-Ig, Clone: 2G4B2 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

• Featured Product
• KD/KO Validated

Caspase 3/P17/P19 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66470-2-Ig

Clone No.2G4B2

Publications(359)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CASP3, Caspase3, 2G4B2, CASP 3, CASP-3

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, HeLa cells
• Positive IHC detected in: human breast cancer tissue, mouse liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 316 publications below
• IHC: See 30 publications below
• IF: See 27 publications below

Product Information

66470-2-Ig targets Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, canine, chicken, plant
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25029

  Product name: Recombinant human CASP3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 31-176 aa of BC016926

  Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS

• Full Name: caspase 3, apoptosis-related cysteine peptidase
• Calculated Molecular Weight: 277 aa, 32 kDa
• Observed Molecular Weight: 32-35 kDa, 19 kDa, 17 kDa
• GenBank Accession Number: BC016926
• Gene Symbol: Caspase 3
• Gene ID (NCBI): 836
• RRID: AB_2876892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P42574
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy; Authors - Lihao Jin
rat,mouse	WB,IHC	Acta Pharm Sin B; Protocatechuic aldehyde protects cardiomycoytes against ischemic injury via regulation of nuclear pyruvate kinase M2.; Authors - Xunxun Wu
mouse	IHC	Biomaterials; Drug-device-field integration for mitochondria-targeting dysfunction and tumor therapy by home-tailored pyroelectric nanocomposites; Authors - Zhe Liu
human	WB	Small; Inherent Capability of Self-Assembling Nanostructures in Specific Proteasome Activation for Cancer Cell Pyroptosis; Authors - Qian-Wei Luo
mouse	WB	Nat Commun; BNC1 deficiency-triggered ferroptosis through the NF2-YAP pathway induces primary ovarian insufficiency; Authors - Feixia Wang
rat	WB	Acta Biomater; Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury.; Authors - Shanshan Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

K. (Verified Customer) (10-26-2023)

This Ab is working good for human, rat and mouse proteins samples.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Human Liver cells