• Featured Product
  • KD/KO Validated

Caveolin-1 Polyclonal antibody

Caveolin-1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 16447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Caveolin 1, CAV1, MSTP085, CGL3, CAV

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, NIH/3T3 cells
Positive IP detected inA549 cells
Positive IHC detected inhuman breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16447-1-AP targets Caveolin-1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, monkey, zebrafish, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8049

Product name: Recombinant human Caveolin-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 11-179 aa of BC006432

Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Predict reactive species
Full Name caveolin 1, caveolae protein, 22kDa
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC006432
Gene Symbol CAV1
Gene ID (NCBI) 857
RRIDAB_10732595
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ03135
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051).

Protocols

Product Specific Protocols
IHC protocol for Caveolin-1 antibody 16447-1-APDownload protocol
IP protocol for Caveolin-1 antibody 16447-1-APDownload protocol
WB protocol for Caveolin-1 antibody 16447-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

RAB31 marks and controls an ESCRT-independent exosome pathway.

Authors - Denghui Wei
humanWB

Nucleic Acids Res

Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis.

Authors - Huawei Wang
mouseWB

Dev Cell

Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells.

Authors - Yan Gong
human,mouseWB,IF

Redox Biol

Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis

Authors - Mengyue You
mouseWB

Biomaterials

Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells.

Authors - Yudong Song
humanIF

Small

Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway.

Authors - Fenfen Kong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sammy (Verified Customer) (01-20-2024)

Excellent antibody for use by western blotting. Diluted in 3% BSA PBST.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: HUVEC
Caveolin-1 Antibody Western Blot validation (1 in 1000 dilution) in HUVEC (Cat no:16447-1-AP)
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

Priya (Verified Customer) (04-17-2023)

Used for Caco2 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 2000
  • Cell Tissue Type: Caco2, Mice colon
FH

Priya (Verified Customer) (04-17-2023)

Used for Caco2 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 2000
  • Cell Tissue Type: Caco2, Mice colon
FH

Emma (Verified Customer) (03-15-2022)

Works really well @ 1:1000 for WB in PC3 and DU145 cells. Single band seen.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Prostate
FH

Kushal (Verified Customer) (08-09-2021)

We tried to use the antibody at high concentrations of 1:100, yet we do not get bands in our blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Caco-2
Loading...
||
New chat Able
正在加载,请稍候...