CBX5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83258-6-RR (same clone as 83258-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83258-6-RR (CBX5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83258-6-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 83258-6-RR (same clone as 83258-6-PBS)

  WB result of CBX5 antibody (83258-6-RR; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-CBX5 transfected K-562 cells. This data was developed using the same antibody clone with 83258-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83258-6-RR (same clone as 83258-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CBX5 antibody (83258-6-RR, Clone: 240145G12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83258-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83258-6-RR (same clone as 83258-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CBX5 antibody (83258-6-RR, Clone: 240145G12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83258-6-PBS in a different storage buffer formulation.

• 

  ChIP experiment of NIH/3T3 using 83258-6-RR (same clone as 83258-6-PBS)

  Chromatin was prepared from NIH/3T3 cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of CBX5 (83258-6-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 83258-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83258-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83258-6-RR against Human CBX5 were performed. The affinity constant is 0.606 nM.

• Featured Product
• KD/KO Validated

CBX5 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA, ChIP-qPCR

Cat No. 83258-6-PBS

Clone No.240145G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA, ChIP-qPCR

Synonyms

240145G12, Antigen p25, HP1, HP1 alpha, HP1A

---

Product Information

83258-6-PBS targets CBX5 in WB, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34810

  Product name: Recombinant human CBX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-120 aa of BC006821

  Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG

• Full Name: chromobox homolog 5 (HP1 alpha homolog, Drosophila)
• Calculated Molecular Weight: 191 aa, 22 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC006821
• Gene Symbol: CBX5
• Gene ID (NCBI): 23468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P45973
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443).