Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, A431 cells |
| Positive IF/ICC detected in | HepG2 cells |
| Positive ChIP-qPCR detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83258-6-RR targets CBX5 in WB, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34810 Product name: Recombinant human CBX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-120 aa of BC006821 Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG Predict reactive species |
| Full Name | chromobox homolog 5 (HP1 alpha homolog, Drosophila) |
| Calculated Molecular Weight | 191 aa, 22 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC006821 |
| Gene Symbol | CBX5 |
| Gene ID (NCBI) | 23468 |
| RRID | AB_3670930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P45973 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CBX5 antibody 83258-6-RR | Download protocol |
| WB protocol for CBX5 antibody 83258-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











