• Featured Product
  • KD/KO Validated

CCL14 Polyclonal antibody

CCL14 Polyclonal Antibody for IHC, ELISA
Cat No. 14216-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

C C motif chemokine 14, CC 1, CC 3, CCL14, Chemokine CC 1/CC 3, CKb1, HCC 1, HCC 1(1 74), HCC 1/HCC 3, HCC 3, MCIF, NCC 2, NCC2, SCYA14, SCYL2, Small inducible cytokine A14, SY14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman liver cancer tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14216-1-AP targets CCL14 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5439

Product name: Recombinant human CCL14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-93 aa of BC045165

Sequence: MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Predict reactive species
Full Name chemokine (C-C motif) ligand 14
Calculated Molecular Weight 11 kDa
GenBank Accession NumberBC045165
Gene Symbol CCL14
Gene ID (NCBI) 6358
RRIDAB_2878029
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16627
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CCL14 antibody 14216-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Cancer Sci

Matrix metalloproteinase-21 promotes metastasis via increasing the recruitment and M2 polarization of macrophages in HCC

Authors - Jiangfan Zhou
  • KD Validated
humanIF

BMC Cancer

Characterization and clinical verification of immune-related genes in hepatocellular carcinoma to aid prognosis evaluation and immunotherapy

Authors - Jialin Qu
Loading...
||
New chat Able
正在加载,请稍候...