Tested Applications
Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells, Transfected HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26614-1-AP targets CCL4/MIP-1 beta in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25070 Product name: Recombinant human CCL4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC107433 Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN Predict reactive species |
Full Name | chemokine (C-C motif) ligand 4 |
Calculated Molecular Weight | 92 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC107433 |
Gene Symbol | CCL4/MIP-1 beta |
Gene ID (NCBI) | 6351 |
RRID | AB_3669554 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P13236 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CCL4/MIP-1 beta antibody 26614-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |