CCR3 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human lymphoma using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens).

CCR3 Polyclonal Antibody for IHC, ELISA

Cat No. 22351-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, IF, ELISA

Synonyms

C C chemokine receptor type 3, C C CKR 3, CC CKR 3, CCR 3, CCR3, CD193, CKR3, CMKBR3, Eosinophil eotaxin receptor

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

22351-1-AP targets CCR3 in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17926

  Product name: Recombinant human CCR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-354 aa of BC110297

  Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV

• Full Name: chemokine (C-C motif) receptor 3
• Calculated Molecular Weight: 355 aa, 41 kDa
• GenBank Accession Number: BC110297
• Gene Symbol: CCR3
• Gene ID (NCBI): 1232
• RRID: AB_2879085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P51677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Int Immunopharmacol; Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte; Authors - Lingwei Bu
mouse	IF	Theranostics; CD34+ PI16+ fibroblast progenitors aggravate neointimal lesions of allograft arteries via CCL11/CCR3-PI3K/AKT pathway; Authors - Xiaodong Xu
human,mouse	IHC	Oncol Rep; SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy; Authors - Gongjie Ye