CD21 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 28206-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28206-1-AP (CD21 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 28206-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28206-1-AP (CD21 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 28206-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD21 antibody (28206-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human tonsillitis using 28206-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD21 antibody (28206-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CD21 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 28206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IHC, IF-P, ELISA

Synonyms

C3DR, CD21, Complement C3d receptor, Complement receptor type 2, CR2, EBV receptor, Epstein Barr virus receptor, SLEB9

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28206-1-AP targets CD21 in IHC, IF-P, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27971

  Product name: Recombinant human CR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 660-718 aa of BC136394

  Sequence: GCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE

• Full Name: complement component (3d/Epstein Barr virus) receptor 2
• Calculated Molecular Weight: 1092 aa, 119 kDa
• GenBank Accession Number: BC136394
• Gene Symbol: CD21
• Gene ID (NCBI): 1380
• ENSEMBL Gene ID: ENSG00000117322
• RRID: AB_2881087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20023
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD21, also known as complement receptor type 2 (CR2), complement C3d receptor, and Epstein-Barr virus receptor, is a transmembrane protein that contains a small cytoplasmic domain, a transmembrane region and an extracellular domain consisting of 15 tandem short consensus repeat sequences (PMID: 6230668; 2551147). It is expressed on B cells, follicular dendritic cells, thymocytes and a subset of peripheral T cells (PMID: 26119182). CD21 binds complement fragments C3d, C3dg and iC3b and acts as a receptor for the Epstein-Barr virus (PMID: 7753047). On B cells, together with CD19 and CD81, CD21 forms a complex that functions as a co-receptor to the BCR (PMID: 7542009). It is involved in B cells activation and functions.