Recombinant human CD24 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag0654
Synonyms
CD24, CD24A, CD antigen, CD antigens, CD marker
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
(1-80 aa encoded by BC007674) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
