CD3 epsilon Polyclonal antibody

• 

  WB analysis using 31889-1-AP

  Rat thymus tissue was subjected to SDS PAGE followed by western blot with 31889-1-AP (CD3 epsilon/CD3e antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat spleen using 31889-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31889-1-AP (CD3 epsilon antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD3 epsilon Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31889-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IHC, ELISA

Synonyms

CD3e, T-cell surface glycoprotein CD3 epsilon chain

---

Tested Applications

• Positive WB detected in: rat thymus tissue
• Positive IHC detected in: rat spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31889-1-AP targets CD3 epsilon in WB, IHC, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1450

  Product name: Recombinant Rat CD3 epsilon protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-103 aa of NP_001101610.2

  Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY

• Full Name: CD3 molecule, epsilon polypeptide
• Calculated Molecular Weight: 22kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NP_001101610.2
• Gene Symbol: Cd3e
• Gene ID (NCBI): 315609
• RRID: AB_3670133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6J423
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This polyclonal antibody was raised against the epsilon chain of rat CD3 molecule.