CD31 Recombinant monoclonal antibody

• 

  WB analysis using 80530-1-RR

  Untreated and PNGase F-treated lysates of human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 80530-1-RR (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 80530-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80530-1-RR (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 80530-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80530-1-RR (CD31 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 80530-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80530-1-RR (CD31 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HUVEC using 80530-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using CD31 antibody (80530-1-RR, Clone: 4N13 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 80530-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80530-1-RR against Human CD31 were performed. The affinity constant is below 1 pM.

CD31 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 80530-1-RR

Clone No.4N13

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

4N13, EndoCAM, GPIIA, GPIIA', PECA1

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets, MOLT-4 cells, Jurkat cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 4 publications below

Product Information

80530-1-RR targets CD31 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1787

  Product name: Recombinant human CD31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 428-738 aa of BC022512

  Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Full Name: platelet/endothelial cell adhesion molecule
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC022512
• Gene Symbol: CD31
• Gene ID (NCBI): 5175
• ENSEMBL Gene ID: ENSG00000261371
• RRID: AB_2918900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16284
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Ecotoxicol Environ Saf; Polystyrene nanoplastics accelerate atherosclerosis: Unraveling the impact on smooth muscle cells through KIF15-mediated migration; Authors - Yizhou Zhong
	IF	Gut Microbes; Resveratrol amplifies the anti-tumor effect of α-PD-1 by altering the intestinal microbiome and PGD2 content; Authors - Baohua Luo
mouse	IF	Biochim Biophys Acta Mol Basis Dis; Early intervention with pericyte Fli-1 post-TBI attenuates hippocampal BBB disruption and subsequent neuroinflammation with neurological deficits; Authors - Minghao Du
rat,mouse	IF	Bioact Mater; Sequential simulation of regeneration-specific microenvironments using scaffolds loaded with nanoplatelet vesicles enhances bone regeneration; Authors - Wenshuai Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

alessandra (Verified Customer) (05-11-2023)

dopo le prove non abbiamo ritenuto utile eseguire l'IF con CD31, che abbiamo sostituito con una doppia con altro anticorpo

• Applications: Immunofluorescence
• Cell Tissue Type: tessuto/ cordone ombelicale

CD31 Antibody Immunofluorescence validation ( dilution) in tessuto/ cordone ombelicale (Cat no:80530-1-RR)