Tested Applications
Positive WB detected in | HL-60 cells, TF-1 cells |
Positive IHC detected in | human tonsillitis tissue, human gliomas tissue, human hysteromyoma tissue, human liver cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human tonsillitis tissue, human liver cancer tissue, human placenta tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 17 publications below |
IHC | See 47 publications below |
IF | See 28 publications below |
FC | See 2 publications below |
Product Information
14486-1-AP targets CD34 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, pig, rabbit, bovine, sheep |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5887 Product name: Recombinant human CD34 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 34-287 aa of BC039146 Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS Predict reactive species |
Full Name | CD34 molecule |
Calculated Molecular Weight | 41 kDa |
Observed Molecular Weight | 100-120 kDa |
GenBank Accession Number | BC039146 |
Gene Symbol | CD34 |
Gene ID (NCBI) | 947 |
RRID | AB_2228975 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P28906 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD34 antibody 14486-1-AP | Download protocol |
IHC protocol for CD34 antibody 14486-1-AP | Download protocol |
IF protocol for CD34 antibody 14486-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cancer m6A methylation reader IGF2BP2 activates endothelial cells to promote angiogenesis and metastasis of lung adenocarcinoma | ||
Sci Adv Self-powered enzyme-linked microneedle patch for scar-prevention healing of diabetic wounds | ||
Nat Commun ICAM1 initiates CTC cluster formation and trans-endothelial migration in lung metastasis of breast cancer. | ||
J Hepatol Intratumoral neutrophils: a poor prognostic factor for hepatocellular carcinoma following resection. | ||
Theranostics Ligand Activation of PPARγ by Ligustrazine Suppresses Pericyte Functions of Hepatic Stellate Cells via SMRT-Mediated Transrepression of HIF-1α. | ||
Bioact Mater Novel magnetic silk fibroin scaffolds with delayed degradation for potential long-distance vascular repair. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Madan Kumar (Verified Customer) (07-13-2021) | Rat primary hepatocyte cells were subjected to SDS PAGE and performed western blot analysis with CD34 antibody (Cat log# 14486-1-AP). This antibody works good.
|