CD47 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD47 Polyclonal antibody (20305-1-AP)

CD47 Polyclonal Antibody for IHC, ELISA

Cat No. 20305-1-AP

Publications(63)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

MER6, Leukocyte surface antigen CD47, Integrin-associated protein, Integrin associated protein, IAP

• 

  IHC staining of human prostate cancer using 20305-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20305-1-AP (CD47 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20305-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20305-1-AP (CD47 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 20305-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20305-1-AP (CD47 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 20305-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20305-1-AP (CD47 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20305-1-AP targets CD47 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14132

  Product name: Recombinant human CD47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC010016

  Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• RRID: AB_10732838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Mol Cancer; Targeting the CD47-HCK-LGALS9 axis disrupts proliferation-immunosuppression coupling in early-stage endometrial cancer.; Authors - Jingxuan Ye
human,mouse	IF	Adv Mater; Efficient Delivery of Lomitapide Using Hybrid Membrane-Coated Tetrahedral DNA Nanostructures for Glioblastoma Therapy; Authors - Mingming Song
human	WB	Bioact Mater; A closed-loop myocardial infarction theranostic platform activated by macrophage-derived nitric oxide and acidic microenvironment.; Authors - Xuan Xu
human	WB	J Extracell Vesicles; Engineering high-affinity dual targeting cellular nanovesicles for optimised cancer immunotherapy; Authors - Luyao Zhang
human	IHC	Nat Commun; USP2 inhibition unleashes CD47-restrained phagocytosis and enhances anti-tumor immunity; Authors - Panpan Dai
human	WB	J Nanobiotechnology; UBQLN1 Inhibition reduces MASH progression through downregulating SIKE/p38 MAPK pathway in hepatocyte.; Authors - Yifei Chen