Recombinant human CD74 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag25499
Synonyms
CD74, Class-II-associated invariant chain peptide, DHLAG, HLADG, HLA-DR antigens-associated invariant chain
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA
(1-48 aa encoded by BC018726) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
