• Featured Product
  • KD/KO Validated

CD81 Monoclonal antibody

CD81 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66866-1-Ig
Clone No.1G2C6

Host / Isotype

Mouse / IgG1

Reactivity

human and More (3)

Applications

WB, IHC, IF-P, ELISA

1G2C6, 26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, HCT 116 cells, HEK-293 cells, Jurkat cells, LPS treated THP-1 cells, Ramos cells, Daudi cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:600-1:2400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66866-1-Ig targets CD81 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, monkey
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27298

Product name: Recombinant human CD81 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 114-199 aa of BC002978

Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS

Predict reactive species
Full Name CD81 molecule
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC002978
Gene Symbol CD81
Gene ID (NCBI) 975
ENSEMBL Gene IDENSG00000110651
RRIDAB_2882203
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP60033
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).

Protocols

Product Specific Protocols
WB protocol for CD81 antibody 66866-1-IgDownload protocol
IHC protocol for CD81 antibody 66866-1-IgDownload protocol
IF protocol for CD81 antibody 66866-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Gastroenterology

PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis

Authors - Tian-Yi Jiang
humanWB

J Am Chem Soc

Efficient Metabolomics Profiling from Plasma Extracellular Vesicles Enables Accurate Diagnosis of Early Gastric Cancer

Authors - Fanqin Bu
humanWB

J Extracell Vesicles

Extracellular vesicles from lung tissue drive bone marrow neutrophil recruitment in inflammation.

Authors - Bowen Liu
WB

Sci Adv

Avian ANP32A incorporated in avian influenza A virions promotes interspecies transmission by priming early viral replication in mammals

Authors - Lei Na
humanWB

J Exp Clin Cancer Res

Circular RNA circATP9A promotes non-small cell lung cancer progression by interacting with HuR and by promoting extracellular vesicles-mediated macrophage M2 polarization

Authors - Yuanshan Yao
humanWB,IF

J Exp Clin Cancer Res

Chemotherapy-elicited extracellular vesicle CXCL1 from dying cells promotes triple-negative breast cancer metastasis by activating TAM/PD-L1 signaling

Authors - Shengqi Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Xiaogang (Verified Customer) (10-21-2021)

I recently bought this CD81 antibody to detect CD81 from EVs purified from human and mouse cell lines. The antibody works well to detect CD81 by immunoblot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: RAW264.7 and differentiated THP-1 cells
CD81 Antibody Western Blot validation (1:1000 dilution) in RAW264.7 and differentiated THP-1 cells (Cat no:66866-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...