CD86 Polyclonal antibody

CD86 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13395-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IF/ICC, ELISA, Cell treatment

Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70, BU63

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, Raji cells, Ramos cells, RAW 264.7 cells
Positive IF/ICC detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13395-1-AP targets CD86 in WB, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4063

Product name: Recombinant human CD86 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-247 aa of BC040261

Sequence: KIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Predict reactive species
Full Name CD86 molecule
Calculated Molecular Weight 329 aa, 38 kDa
Observed Molecular Weight 60-80 kDa
GenBank Accession NumberBC040261
Gene Symbol CD86
Gene ID (NCBI) 942
ENSEMBL Gene IDENSG00000114013
RRIDAB_2074882
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42081
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. This antibody detects a band of approximately 65-70 kDa, consistent with glycosylated form of CD86 (PMID: 8592066, 21849678).

Protocols

Product Specific Protocols
WB protocol for CD86 antibody 13395-1-APDownload protocol
IF protocol for CD86 antibody 13395-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Adv Mater

Engineered Bacterial Outer Membrane Vesicles as Controllable Two-way Adaptors to Activate Macrophage Phagocytosis for Improved Tumor Immunotherapy

Authors - Qingqing Feng
mouseWB,IF

Adv Mater

Photosensitive Biomimetic Nanomedicine-Mediated Recombination of Adipose Microenvironments for Antiobesity Therapy

Authors - Mingming Song
humanIF

Adv Sci (Weinh)

Turmeric-Derived Nanoparticles Functionalized Aerogel Regulates Multicellular Networks to Promote Diabetic Wound Healing

Authors - Bodeng Wu
mouse

Acta Pharm Sin B

Converting bacteria into autologous tumor vaccine via surface biomineralization of calcium carbonate for enhanced immunotherapy

Authors - Lina Guo
mouseIF

Biomaterials

Implantation of MSC spheroid-derived 3D decellularized ECM enriched with the MSC secretome ameliorates traumatic brain injury and promotes brain repair

Authors - Grace H Chen
ratIF

Adv Healthc Mater

A ROS-Responsive Liposomal Composite Hydrogel Integrating Improved Mitochondrial Function and Pro-Angiogenesis for Efficient Treatment of Myocardial Infarction.

Authors - Zhi Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christin (Verified Customer) (01-26-2025)

I used this antibody to cofirm the differentiation of human iPSCs into macrophages with good results at 1:250 dilution.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Human iPSC-derived macrophages
FH

Martin (Verified Customer) (09-28-2022)

Antibody is working very well

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:300
Loading...