CD86 Polyclonal antibody

• 

  WB analysis using 13395-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13395-1-AP (CD86 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 13395-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CD86 antibody (13395-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CD86 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13395-1-AP

Publications(295)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IF/ICC, ELISA, Cell treatment

Synonyms

Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70, BU63

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Ramos cells, RAW 264.7 cells
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 100 publications below
• IHC: See 1 publications below
• IF: See 187 publications below

Product Information

13395-1-AP targets CD86 in WB, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4063

  Product name: Recombinant human CD86 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-247 aa of BC040261

  Sequence: KIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

• Full Name: CD86 molecule
• Calculated Molecular Weight: 329 aa, 38 kDa
• Observed Molecular Weight: 60-80 kDa
• GenBank Accession Number: BC040261
• Gene Symbol: CD86
• Gene ID (NCBI): 942
• ENSEMBL Gene ID: ENSG00000114013
• RRID: AB_2074882
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42081
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. This antibody detects a band of approximately 65-70 kDa, consistent with glycosylated form of CD86 (PMID: 8592066, 21849678).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Mater; Engineered Bacterial Outer Membrane Vesicles as Controllable Two-way Adaptors to Activate Macrophage Phagocytosis for Improved Tumor Immunotherapy; Authors - Qingqing Feng
mouse	WB,IF	Adv Mater; Photosensitive Biomimetic Nanomedicine-Mediated Recombination of Adipose Microenvironments for Antiobesity Therapy; Authors - Mingming Song
human	IF	Adv Sci (Weinh); Turmeric-Derived Nanoparticles Functionalized Aerogel Regulates Multicellular Networks to Promote Diabetic Wound Healing; Authors - Bodeng Wu
mouse		Acta Pharm Sin B; Converting bacteria into autologous tumor vaccine via surface biomineralization of calcium carbonate for enhanced immunotherapy; Authors - Lina Guo
mouse	IF	Biomaterials; Implantation of MSC spheroid-derived 3D decellularized ECM enriched with the MSC secretome ameliorates traumatic brain injury and promotes brain repair; Authors - Grace H Chen
rat	IF	Adv Healthc Mater; A ROS-Responsive Liposomal Composite Hydrogel Integrating Improved Mitochondrial Function and Pro-Angiogenesis for Efficient Treatment of Myocardial Infarction.; Authors - Zhi Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Christin (Verified Customer) (01-26-2025)

I used this antibody to cofirm the differentiation of human iPSCs into macrophages with good results at 1:250 dilution.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: Human iPSC-derived macrophages

FH

Martin (Verified Customer) (09-28-2022)

Antibody is working very well

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:300