Tested Applications
| Positive WB detected in | MOLT-4 cells, human peripheral blood leukocyte |
| Positive IHC detected in | human tonsillitis tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 115 publications below |
| IF | See 89 publications below |
Product Information
66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species |
| Full Name | CD8a molecule |
| Calculated Molecular Weight | 235 aa, 26 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC025715 |
| Gene Symbol | CD8A |
| Gene ID (NCBI) | 925 |
| ENSEMBL Gene ID | ENSG00000153563 |
| RRID | AB_2882205 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01732 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD8a antibody 66868-1-Ig | Download protocol |
| IHC protocol for CD8a antibody 66868-1-Ig | Download protocol |
| WB protocol for CD8a antibody 66868-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
ACS Nano Tailoring Chemoimmunostimulant Bioscaffolds for Inhibiting Tumor Growth and Metastasis after Incomplete Microwave Ablation. | ||
Cancer Commun (Lond) Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies | ||
Adv Sci (Weinh) HIC1 suppresses Tumor Progression and Enhances CD8+ T Cells Infiltration Through Promoting GSDMD-induced Pyroptosis in Gastric Cancer | ||
Cell Rep Med Distinctive multicellular immunosuppressive hubs confer different intervention strategies for left- and right-sided colon cancers | ||
J Med Virol Combination of novel oncolytic herpesvirus with paclitaxel as an efficient strategy for breast cancer therapy |

















































