CD8a Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD8a Monoclonal antibody (66868-1-Ig)

CD8a Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66868-1-Ig

Clone No.1G2B10

Publications(298)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD8, 1G2B10, CD8a molecule, Leu2, MAL

• 

  WB analysis of MOLT-4 using 66868-1-Ig

  MOLT-4 cells were subjected to SDS PAGE followed by western blot with 66868-1-Ig (CD8a antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood leukocyte using 66868-1-Ig

  Human peripheral blood leukocyte cells were subjected to SDS PAGE followed by western blot with 66868-1-Ig (CD8a antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human pancreas cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human appendicitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:4000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human appendicitis using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:4000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human pancreas cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66868-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 66868-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD8a antibody (66868-1-Ig, Clone: 1G2B10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 66868-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD8a antibody (66868-1-Ig, Clone: 1G2B10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, human peripheral blood leukocyte
• Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:10000-1:40000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IHC: See 160 publications below
• IF: See 125 publications below

Product Information

66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, bovine
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11111

  Product name: Recombinant human CD8A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 23-183 aa of BC025715

  Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI

• Full Name: CD8a molecule
• Calculated Molecular Weight: 235 aa, 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC025715
• Gene Symbol: CD8A
• Gene ID (NCBI): 925
• ENSEMBL Gene ID: ENSG00000153563
• RRID: AB_2882205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P01732
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Metab; Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer; Authors - Yu Jiang
	IF	ACS Nano; Tailoring Chemoimmunostimulant Bioscaffolds for Inhibiting Tumor Growth and Metastasis after Incomplete Microwave Ablation.; Authors - Yuting Shen
	IHC	Cancer Commun (Lond); Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies; Authors - Lu Tang
		ACS Nano; Biomineralized Albumin-Macrocyclic Conjugates for Synergistic Metal Ion-Based Combination Therapy in Cancer Treatment; Authors - Yu Zhang
human	IF	Adv Sci (Weinh); HIC1 suppresses Tumor Progression and Enhances CD8+ T Cells Infiltration Through Promoting GSDMD-induced Pyroptosis in Gastric Cancer; Authors - Mengjie Kang
human	IF	Cell Rep Med; Distinctive multicellular immunosuppressive hubs confer different intervention strategies for left- and right-sided colon cancers; Authors - Bingxin Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

GODD FOR IF

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1;100
• Cell Tissue Type: liver tissue