Tested Applications
| Positive IF-P detected in | human appendicitis tissue, human tonsillitis tissue, human colon cancer tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66868 targets CD8a in IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species | 
                                    
| Full Name | CD8a molecule | 
| Calculated Molecular Weight | 235 aa, 26 kDa | 
| GenBank Accession Number | BC025715 | 
| Gene Symbol | CD8A | 
| Gene ID (NCBI) | 925 | 
| ENSEMBL Gene ID | ENSG00000153563 | 
| RRID | AB_2883630 | 
| Conjugate | CoraLite®594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P01732 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 CD8a antibody CL594-66868 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 









