Tested Applications
| Positive WB detected in | fetal human brain tissue, rabbit brain tissue, U2OS cells, human kidney tissue, pig brain tissue, pig spleen tissue, pig colon tissue |
| Positive IHC detected in | human tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 5 publications below |
| IF | See 25 publications below |
| FC | See 3 publications below |
Product Information
66766-1-Ig targets CD90 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
| Full Name | Thy-1 cell surface antigen |
| Calculated Molecular Weight | 161 aa, 18 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC065559 |
| Gene Symbol | CD90/Thy1 |
| Gene ID (NCBI) | 7070 |
| RRID | AB_2882112 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04216 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD90 antibody 66766-1-Ig | Download protocol |
| IHC protocol for CD90 antibody 66766-1-Ig | Download protocol |
| WB protocol for CD90 antibody 66766-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Biol Lett Reciprocal negative feedback between Prrx1 and miR-140-3p regulates rapid chondrogenesis in the regenerating antler | ||
Int J Biol Macromol A light-cured injectable composite hydrogel based on chitosan and decellularized matrix modulates stem cell aggregation behavior for accelerating cartilage defect repair | ||
J Mol Cell Biol Cancer-associated adipocytes-derived G-CSF promotes breast cancer malignancy via Stat3 signaling. | ||
Stem Cell Res Ther Targeting prominin-2/BACH1/GLS pathway to inhibit oxidative stress-induced ferroptosis of bone mesenchymal stem cells | ||
Int J Mol Sci Expression of Cancer Stem Cell Markers EpCAM and CD90 Is Correlated with Anti- and Pro-Oncogenic EphA2 Signaling in Hepatocellular Carcinoma. | ||
Inflamm Bowel Dis Stromal Cell Subsets Show Model-Dependent Changes in Experimental Colitis and Affect Epithelial Tissue Repair and Immune Cell Activation |













































