Tested Applications
| Positive WB detected in | fetal human brain tissue, rabbit brain tissue, U2OS cells, human kidney tissue, pig brain tissue, pig spleen tissue, pig colon tissue |
| Positive IHC detected in | human tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66766-1-Ig targets CD90 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
| Full Name | Thy-1 cell surface antigen |
| Calculated Molecular Weight | 161 aa, 18 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC065559 |
| Gene Symbol | CD90/Thy1 |
| Gene ID (NCBI) | 7070 |
| RRID | AB_2882112 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04216 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD90 antibody 66766-1-Ig | Download protocol |
| IHC protocol for CD90 antibody 66766-1-Ig | Download protocol |
| WB protocol for CD90 antibody 66766-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD90 Monoclonal Antibody (catalog number 66766-1-Ig) has 73 citations. These appear in journals including Nature Communications, Advanced Science, Cell Reports Medicine, Journal of Nanobiotechnology, International Journal of Biological Sciences, Journal of Controlled Release, Cells, and International Journal of Molecular Sciences. Research fields span stem cell biology, tissue regeneration and cartilage repair, rheumatoid arthritis, cancer (hepatocellular, breast, pancreatic), fibrosis, and immunology, with applications in IF, IHC, WB, and flow cytometry.
| Species | Application | Title |
|---|---|---|
Nat Commun Streamlined metal-based hydrogel facilitates stem cell differentiation, extracellular matrix homeostasis and cartilage repair in male rats | ||
Nat Commun Dynamically cultured, differentiated bovine adipose-derived stem cell spheroids as building blocks for biofabricating cultured fat | ||
Nat Commun CD142-positive synovial fibroblasts drive meniscus destruction in rheumatoid arthritis | ||
J Nanobiotechnology All-in-one smart dressing for simultaneous angiogenesis and neural regeneration | ||
Adv Sci (Weinh) TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration. | ||
Adv Sci (Weinh) Sleep Deprivation Aggravates Periodontitis Through Trigeminal-Periodontal Neuroimmune Pathway Mediated by the AChE-ACh-α7nAChR Axis. |
