Product Information
66766-1-PBS targets CD90 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Reactivity | human, mouse, rat, pig, rabbit |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
Full Name | Thy-1 cell surface antigen |
Calculated Molecular Weight | 161 aa, 18 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC065559 |
Gene Symbol | CD90/Thy1 |
Gene ID (NCBI) | 7070 |
RRID | AB_2882112 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P04216 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.