CDK4 Monoclonal antibody

CDK4 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 66950-1-Ig
Clone No.1G2C12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

PSK J3, EC:2.7.11.22, Cyclin-dependent kinase 4, cyclin dependent kinase 4, CMM3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, 4T1 cells, Jurkat cells, MCF-7 cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66950-1-Ig targets CDK4 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20538

Product name: Recombinant human CDK4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-303 aa of BC010153

Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Predict reactive species
Full Name cyclin-dependent kinase 4
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC010153
Gene Symbol CDK4
Gene ID (NCBI) 1019
RRIDAB_2882273
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11802
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).

Protocols

Product Specific Protocols
FC protocol for CDK4 antibody 66950-1-IgDownload protocol
IHC protocol for CDK4 antibody 66950-1-IgDownload protocol
WB protocol for CDK4 antibody 66950-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Phytomedicine

Transcriptomics and molecular docking reveal the potential mechanism of lycorine against pancreatic cancer

Authors - Xin Zhou
humanWB

J Med Chem

Design, Synthesis, and Biological Evaluation for First GPX4 and CDK Dual Inhibitors

Authors - Jiangmin Zhu
humanWB

Cell Oncol (Dordr)

LINC02154 promotes the proliferation and metastasis of hepatocellular carcinoma by enhancing SPC24 promoter activity and activating the PI3K-AKT signaling pathway.

Authors - Huan Yue
humanWB

Front Cell Dev Biol

NLGN3 Upregulates Expression of ADAM10 to Promote the Cleavage of NLGN3 via Activating the LYN Pathway in Human Gliomas.

Authors - Ning-Ning Dang
mouseWB

Front Cell Dev Biol

LHPP-Mediated Histidine Dephosphorylation Suppresses the Self-Renewal of Mouse Embryonic Stem Cells.

Authors - Rong Mu Xia
humanWB

Oxid Med Cell Longev

MICAL2 Contributes to Gastric Cancer Cell Proliferation by Promoting YAP Dephosphorylation and Nuclear Translocation

Authors - Chenxiang Qi
Loading...
||
New chat Able
正在加载,请稍候...