CDK4 Monoclonal antibody, PBS Only

• 

  WB analysis using 66950-1-Ig (same clone as 66950-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 66950-1-Ig (same clone as 66950-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66950-1-Ig (same clone as 66950-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66950-1-Ig (same clone as 66950-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66950-1-Ig (same clone as 66950-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66950-1-Ig (same clone as 66950-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66950-1-Ig (CDK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66950-1-Ig (same clone as 66950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66950-1-Ig (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66950-1-Ig (same clone as 66950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66950-1-Ig (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66950-1-Ig (same clone as 66950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66950-1-Ig (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66950-1-Ig (same clone as 66950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66950-1-Ig (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 66950-1-Ig (same clone as 66950-1-PBS)

  1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug Anti-Human CDK4 (66950-1-Ig, Clone:1G2C12) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66950-1-PBS in a different storage buffer formulation.

CDK4 Monoclonal Antibody for ELISA, IHC, WB

Cat No. 66950-1-PBS

Clone No.1G2C12

Host / Isotype

Mouse / IgG1

Reactivity

rat, mouse, human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

PSK J3, EC:2.7.11.22, Cyclin-dependent kinase 4, cyclin dependent kinase 4, CMM3

---

Product Information

66950-1-PBS targets CDK4 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with rat, mouse, human samples.

• Tested Reactivity: rat, mouse, human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20538

  Product name: Recombinant human CDK4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-303 aa of BC010153

  Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

• Full Name: cyclin-dependent kinase 4
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC010153
• Gene Symbol: CDK4
• Gene ID (NCBI): 1019
• RRID: AB_2882273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11802
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).