Tested Applications
Positive WB detected in | HeLa cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 6 publications below |
IHC | See 3 publications below |
IF | See 10 publications below |
IP | See 2 publications below |
Product Information
22490-1-AP targets CEP290 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17457 Product name: Recombinant human CEP290 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-237 aa of BC008641 Sequence: QMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV Predict reactive species |
Full Name | centrosomal protein 290kDa |
Calculated Molecular Weight | 2479 aa, 290 kDa |
Observed Molecular Weight | 290 kDa |
GenBank Accession Number | BC008641 |
Gene Symbol | CEP290 |
Gene ID (NCBI) | 80184 |
RRID | AB_10973679 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15078 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Studies in the Chlamydomonas model system has shown that the ciliary protein CEP290 is a critical component of these Y-link junctions. Additionally, numerous studies have demonstrated that CEP290's function is critical for IFT-in CEP290 knockdown experiments, many proteins that would normally localize to the cilium fail to do so, and cilium formation is disrupted or absent. Mutations in CEP290 are accountable for cases of nephronophthisis, Leber congenital amaurosis and Joubert syndrome. In IF analtsis of HeLa cells, the white arrows show centrosome and cilium staining. Two isoforms were produced by alternative splicing with predicted MW of 290 and 180 kDa according to UniProt. Catalog#22490-1-AP can recognise both.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CEP290 antibody 22490-1-AP | Download protocol |
IHC protocol for CEP290 antibody 22490-1-AP | Download protocol |
IF protocol for CEP290 antibody 22490-1-AP | Download protocol |
IP protocol for CEP290 antibody 22490-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep A CEP290 C-Terminal Domain Complements the Mutant CEP290 of Rd16 Mice In Trans and Rescues Retinal Degeneration. | ||
EMBO Rep Trichoplein binds PCM1 and controls endothelial cell function by regulating autophagy. | ||
Aging (Albany NY) Centrosomal protein 290 is a novel prognostic indicator that modulates liver cancer cell ferroptosis via the Nrf2 pathway.
| ||
J Biol Chem DAZ interacting protein 1 (Dzip1) phosphorylation by Polo-like kinase 1 (Plk1) regulates the centriolar satellites localization of the BBSome during the cell cycle. | ||
J Biol Chem The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jay (Verified Customer) (11-08-2019) | Human RPE1 cell line with Methanol fixation.Immunostaining result shows that CEP290 localizes to centrosome (Red; CEP290, Green; CEP164 for Centrosome marker, Blue;DAPI for Nucleus).The antibody seems to detect additional nucleoli signals.
![]() |